Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 28323.m000041 |
Family | GH13 |
Protein Properties | Length: 221 Molecular Weight: 24745.1 Isoelectric Point: 7.3184 |
Chromosome | Chromosome/Scaffold: 28323 Start: 62 End: 726 |
Description | starch branching enzyme 2.1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH13 | 38 | 219 | 9.80068e-42 |
RQFSKEGTLNAVAASLPRLRQMGVDIVWLMPIHPIGQKNRKGTLGSYYAVADYTAVNPEFGTVDDMRKLVRQAHALGMHVILDWVGNHTAWDHPWVQQHP DWYKKNDKGEIYAVTLKNDAGGADEWTDVVGLDYDNKDLWKGMTEAMAFWVKDVGVDGFRADAASLVPTAFWDQARAQLDKI |
Full Sequence |
---|
Protein Sequence Length: 221 Download |
MKKLAASLIL ATLFTAAHAE PKHPAWSRGS NVYEVNTRQF SKEGTLNAVA ASLPRLRQMG 60 VDIVWLMPIH PIGQKNRKGT LGSYYAVADY TAVNPEFGTV DDMRKLVRQA HALGMHVILD 120 WVGNHTAWDH PWVQQHPDWY KKNDKGEIYA VTLKNDAGGA DEWTDVVGLD YDNKDLWKGM 180 TEAMAFWVKD VGVDGFRADA ASLVPTAFWD QARAQLDKIK P |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0366 | AmyA | 1.0e-30 | 30 | 221 | 227 | + Glycosidases [Carbohydrate transport and metabolism] | ||
TIGR02456 | treS_nterm | 3.0e-32 | 26 | 200 | 204 | + trehalose synthase. Trehalose synthase interconverts maltose and alpha, alpha-trehalose by transglucosylation. This is one of at least three mechanisms for biosynthesis of trehalose, an important and widespread compatible solute. However, it is not driven by phosphate activation of sugars and its physiological role may tend toward trehalose degradation. This view is accentuated by numerous examples of fusion to a probable maltokinase domain. The sequence region described by this model is found both as the whole of a trehalose synthase and as the N-terminal region of a larger fusion protein that includes trehalose synthase activity. Several of these fused trehalose synthases have a domain homologous to proteins with maltokinase activity from Actinoplanes missouriensis and Streptomyces coelicolor (PMID:15378530) [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
cd11316 | AmyAc_bac2_AmyA | 3.0e-36 | 31 | 221 | 232 | + Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes Chloroflexi, Dictyoglomi, and Fusobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. | ||
cd11344 | AmyAc_GlgE_like | 1.0e-36 | 33 | 221 | 216 | + Alpha amylase catalytic domain found in GlgE-like proteins. GlgE is a (1,4)-a-D-glucan:phosphate a-D-maltosyltransferase, involved in a-glucan biosynthesis in bacteria. It is also an anti-tuberculosis drug target. GlgE isoform I from Streptomyces coelicolor has the same catalytic and very similar kinetic properties to GlgE from Mycobacterium tuberculosis. GlgE from Streptomyces coelicolor forms a homodimer with each subunit comprising five domains (A, B, C, N, and S) and 2 inserts. Domain A is a catalytic alpha-amylase-type domain that along with domain N, which has a beta-sandwich fold and forms the core of the dimer interface, binds cyclodextrins. Domain A, B, and the 2 inserts define a well conserved donor pocket that binds maltose. Cyclodextrins competitively inhibit the binding of maltooligosaccharides to the S. coelicolor enzyme, indicating that the hydrophobic patch overlaps with the acceptor binding site. This is not the case in M. tuberculosis GlgE because cyclodextrins do not inhibit this enzyme, despite acceptor length specificity being conserved. Domain C is hypothesized to help stabilize domain A and could be involved in substrate binding. Domain S is a helix bundle that is inserted within the N domain and it plays a role in the dimer interface and interacts directly with domain B. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. | ||
cd11313 | AmyAc_arch_bac_AmyA | 2.0e-110 | 26 | 221 | 196 | + Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase). AmyA (EC 3.2.1.1) catalyzes the hydrolysis of alpha-(1,4) glycosidic linkages of glycogen, starch, related polysaccharides, and some oligosaccharides. This group includes firmicutes, bacteroidetes, and proteobacteria. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003824 | catalytic activity |
GO:0005975 | carbohydrate metabolic process |
GO:0043169 | cation binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002535253.1 | 0 | 1 | 221 | 1 | 221 | alpha-amylase, putative [Ricinus communis] |
RefSeq | XP_002538047.1 | 0 | 59 | 221 | 1 | 162 | alpha-amylase, putative [Ricinus communis] |
RefSeq | YP_003007378.1 | 0 | 10 | 221 | 4 | 208 | alpha amylase, catalytic region [Aggregatibacter aphrophilus NJ8700] |
RefSeq | YP_003060839.1 | 0 | 18 | 221 | 43 | 239 | alpha amylase catalytic region [Hirschia baltica ATCC 49814] |
RefSeq | YP_003387358.1 | 0 | 15 | 220 | 34 | 237 | alpha amylase catalytic region [Spirosoma linguale DSM 74] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3dhu_D | 0 | 28 | 221 | 11 | 194 | A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum |
PDB | 3dhu_C | 0 | 28 | 221 | 11 | 194 | A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum |
PDB | 3dhu_B | 0 | 28 | 221 | 11 | 194 | A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum |
PDB | 3dhu_A | 0 | 28 | 221 | 11 | 194 | A Chain A, Crystal Structure Of An Alpha-Amylase From Lactobacillus Plantarum |
PDB | 4gkl_B | 0 | 32 | 220 | 8 | 190 | A Chain A, Crystal Structure Of A Noncanonic Maltogenic Alpha-amylase Amyb From Thermotoga Neapolitana |