Basic Information | |
---|---|
Species | Ricinus communis |
Cazyme ID | 55201.m000024 |
Family | GT4 |
Protein Properties | Length: 247 Molecular Weight: 27324.2 Isoelectric Point: 8.944 |
Chromosome | Chromosome/Scaffold: 55201 Start: 17 End: 760 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 56 | 205 | 7.5e-30 |
PTRQPTLIYFGRWSVNKGLREALQVLRALRARDAAWSLTIAGREYDYRAADLHALAAEFGVDEAVRLVASPSDAELRTLMHSASYFICLSQHEGFGLAAV EAMSAGLIPLLSAIPPFQKLAKDTGVPLLLKADPTRAAAAIQALHERPET |
Full Sequence |
---|
Protein Sequence Length: 247 Download |
MLFFNTVTRF TSRGYARVLA TSTNDGEIFA RIIRDERLRV IENGVDIDKY ADAAAPTRQP 60 TLIYFGRWSV NKGLREALQV LRALRARDAA WSLTIAGREY DYRAADLHAL AAEFGVDEAV 120 RLVASPSDAE LRTLMHSASY FICLSQHEGF GLAAVEAMSA GLIPLLSAIP PFQKLAKDTG 180 VPLLLKADPT RAAAAIQALH ERPETDHTAL REHARLQARR FSWRTVVDAY VAEYERAAAP 240 ATARSLI |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd03798 | GT1_wlbH_like | 2.0e-21 | 9 | 228 | 241 | + This family is most closely related to the GT1 family of glycosyltransferases. wlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS. | ||
cd03809 | GT1_mtfB_like | 2.0e-23 | 33 | 228 | 206 | + This family is most closely related to the GT1 family of glycosyltransferases. mtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide. | ||
pfam00534 | Glycos_transf_1 | 7.0e-24 | 59 | 221 | 165 | + Glycosyl transferases group 1. Mutations in this domain of human PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family. | ||
COG0438 | RfaG | 4.0e-25 | 1 | 228 | 233 | + Glycosyltransferase [Cell envelope biogenesis, outer membrane] | ||
cd03801 | GT1_YqgM_like | 2.0e-27 | 3 | 228 | 239 | + This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EFF46125.1 | 0 | 2 | 237 | 133 | 369 | GumH protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] |
RefSeq | NP_642893.1 | 0 | 2 | 237 | 133 | 369 | GumH protein [Xanthomonas axonopodis pv. citri str. 306] |
RefSeq | XP_002538574.1 | 0 | 1 | 247 | 1 | 247 | glycosyltransferase, putative [Ricinus communis] |
RefSeq | ZP_06483327.1 | 0 | 2 | 237 | 133 | 369 | GumH protein [Xanthomonas campestris pv. vasculorum NCPPB702] |
RefSeq | ZP_06489774.1 | 0 | 2 | 237 | 133 | 369 | GumH protein [Xanthomonas campestris pv. musacearum NCPPB4381] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3fro_C | 0.000000002 | 131 | 234 | 324 | 427 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 3fro_B | 0.000000002 | 131 | 234 | 324 | 427 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 3fro_A | 0.000000002 | 131 | 234 | 324 | 427 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 2bis_C | 0.000000002 | 131 | 234 | 325 | 428 | A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi |
PDB | 2bis_B | 0.000000002 | 131 | 234 | 325 | 428 | A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GE267958 | 152 | 60 | 199 | 0.00006 |
FG009414 | 188 | 49 | 222 | 0.002 |
FG061601 | 188 | 49 | 222 | 0.005 |
EC145477 | 141 | 61 | 189 | 0.006 |
HS411973 | 105 | 122 | 223 | 0.008 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Picea abies | MA_158718g0050 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|