Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_016_00256.2 |
Family | GH16 |
Protein Properties | Length: 216 Molecular Weight: 24692.6 Isoelectric Point: 7.5539 |
Chromosome | Chromosome/Scaffold: 16 Start: 3414414 End: 3418016 |
Description | xyloglucan endotransglucosylase/hydrolase 7 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 2 | 139 | 2.3e-22 |
VSMKIKLIPGDSAGTVTAFYMSSDTTANRDELDFEFLGNRSGQPYTVQTNVFARGKGDREQRVNLWFDPSAQFHTYSILWNRRHIVFYVDDIPIRVYKNN EAKGVPYPNSQPMGIYSTLWEADNWATRGGLEKIDWSK |
Full Sequence |
---|
Protein Sequence Length: 216 Download |
MVSMKIKLIP GDSAGTVTAF YMSSDTTANR DELDFEFLGN RSGQPYTVQT NVFARGKGDR 60 EQRVNLWFDP SAQFHTYSIL WNRRHIVFYV DDIPIRVYKN NEAKGVPYPN SQPMGIYSTL 120 WEADNWATRG GLEKIDWSKA PFYAYYKDFD IEGSTNGLAG AATRSNNWWD APSYQQLSPV 180 QARSYRWVRV NHMVYDYCTD KTRHSVPPPE CLAGI* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00413 | Glyco_hydrolase_16 | 5.0e-19 | 2 | 137 | 149 | + glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
cd02183 | GH16_fungal_CRH1_transglycosylase | 1.0e-28 | 2 | 152 | 166 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
pfam00722 | Glyco_hydro_16 | 5.0e-60 | 2 | 139 | 139 | + Glycosyl hydrolases family 16. | ||
PLN03161 | PLN03161 | 4.0e-85 | 2 | 211 | 216 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
cd02176 | GH16_XET | 2.0e-134 | 2 | 211 | 213 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAS46243.1 | 0 | 2 | 215 | 81 | 295 | xyloglucan endotransglucosylase-hydrolase XTH7 [Solanum lycopersicum] |
GenBank | ABC55454.2 | 0 | 2 | 215 | 73 | 287 | xyloglucan endotransglucosylase/hydrolase 2 [Rosa x borboniana] |
GenBank | ABM91067.1 | 0 | 2 | 215 | 80 | 294 | xyloglucan endotransglycosylase/hydrolase precursor XTH-36 [Populus tremula x Populus tremuloides] |
GenBank | ACD03228.1 | 0 | 2 | 215 | 80 | 294 | xyloglucan endotransglucosylase/hydrolase 4 [Malus x domestica] |
RefSeq | NP_195494.1 | 0 | 2 | 215 | 79 | 293 | xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 3 | 211 | 63 | 272 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 1un1_A | 0 | 3 | 211 | 63 | 272 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 1umz_B | 0 | 3 | 211 | 63 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 3 | 211 | 63 | 272 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2uwb_B | 0 | 6 | 211 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT738634 | 205 | 1 | 205 | 0 |
JZ006485 | 207 | 10 | 216 | 0 |
DT746584 | 195 | 22 | 216 | 0 |
HO116288 | 216 | 2 | 216 | 0 |
DR942503 | 216 | 2 | 216 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|