Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_028_00272.4 |
Family | AA6 |
Protein Properties | Length: 153 Molecular Weight: 16007.2 Isoelectric Point: 6.8023 |
Chromosome | Chromosome/Scaffold: 28 Start: 2715451 End: 2716707 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 2 | 147 | 0 |
SAPPKSDIPIITPSELPEADGLIFGFPTRFGMMAAQFKAFFDATGSLWRTQSLAGKPAGIFYSTGSQGGGQETTALTAITQLVHHGMIFVPIGYTYGAGM FEMENVKGGSPYGAGTYAGDGSRQPTELELEQAFHQGKYIAGFAKK |
Full Sequence |
---|
Protein Sequence Length: 153 Download |
MSAPPKSDIP IITPSELPEA DGLIFGFPTR FGMMAAQFKA FFDATGSLWR TQSLAGKPAG 60 IFYSTGSQGG GQETTALTAI TQLVHHGMIF VPIGYTYGAG MFEMENVKGG SPYGAGTYAG 120 DGSRQPTELE LEQAFHQGKY IAGFAKKLKG GA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
TIGR00675 | dcm | 0.008 | 5 | 48 | 44 | + DNA-methyltransferase (dcm). All proteins in this family for which functions are known are DNA-cytosine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. | ||
pfam03358 | FMN_red | 8.0e-11 | 19 | 95 | 78 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 2.0e-24 | 16 | 139 | 125 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 3.0e-37 | 9 | 141 | 134 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 4.0e-45 | 10 | 141 | 133 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU13985.1 | 0 | 1 | 152 | 52 | 203 | unknown [Glycine max] |
GenBank | ACU19740.1 | 0 | 1 | 152 | 55 | 206 | unknown [Glycine max] |
EMBL | CAA19721.1 | 0 | 1 | 152 | 58 | 209 | putative protein [Arabidopsis thaliana] |
RefSeq | NP_194457.2 | 0 | 1 | 152 | 52 | 203 | quinone reductase family protein [Arabidopsis thaliana] |
RefSeq | XP_002534445.1 | 0 | 1 | 152 | 52 | 203 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 2.00386e-43 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 2.00386e-43 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 2.00386e-43 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_A | 2.00386e-43 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6j_B | 2.00386e-43 | 10 | 150 | 59 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT740518 | 141 | 1 | 141 | 0 |
JZ006269 | 141 | 1 | 141 | 0 |
JG651256 | 141 | 1 | 141 | 0 |
FR636091 | 141 | 1 | 141 | 0 |
FG484327 | 141 | 1 | 141 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|