Basic Information | |
---|---|
Species | Cucumis sativus |
Cazyme ID | Cucsa.201860.1 |
Family | GH18 |
Protein Properties | Length: 213 Molecular Weight: 23107.8 Isoelectric Point: 3.988 |
Chromosome | Chromosome/Scaffold: 01376 Start: 101269 End: 101908 |
Description | chitinase A |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH18 | 4 | 154 | 1.7e-22 |
NSCQSQNVKVLLSIGGGAGSYSLYSADDAKEVANFIWNSYLGGQSDSRPLGDAVLDGVDFDIEFGLDQFWDVLAQELKSFGQVILSAAPQCPIPDAHLDT AIRTGLFHSIWVQFYNNPSCMYADDTDNLLSSWNQWAAYPISKLYMGLPTA |
Full Sequence |
---|
Protein Sequence Length: 213 Download |
NEINSCQSQN VKVLLSIGGG AGSYSLYSAD DAKEVANFIW NSYLGGQSDS RPLGDAVLDG 60 VDFDIEFGLD QFWDVLAQEL KSFGQVILSA APQCPIPDAH LDTAIRTGLF HSIWVQFYNN 120 PSCMYADDTD NLLSSWNQWA AYPISKLYMG LPTAPEAAPS GGYIPVEELI SEVLPIIKAS 180 SNYGGVMLWS KEFDHGYSDA IKDSIYQLKG SS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG3469 | COG3469 | 0.0003 | 129 | 196 | 69 | + Chitinase [Carbohydrate transport and metabolism] | ||
cd02871 | GH18_chitinase_D-like | 0.0002 | 58 | 198 | 196 | + GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus. | ||
pfam00704 | Glyco_hydro_18 | 1.0e-9 | 1 | 153 | 177 | + Glycosyl hydrolases family 18. | ||
cd02877 | GH18_hevamine_XipI_class_III | 3.0e-79 | 2 | 203 | 218 | + This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC37394.1 | 0 | 1 | 211 | 88 | 298 | ORF 1 [Cucumis sativus] |
GenBank | AAC37396.1 | 0 | 1 | 212 | 87 | 298 | ORF 3 [Cucumis sativus] |
GenBank | AAF64474.1 | 0 | 1 | 205 | 87 | 291 | AF241266_1 chitinase 1 [Cucumis melo] |
GenBank | ABA26457.1 | 0 | 1 | 205 | 87 | 291 | acidic class III chitinase [Citrullus lanatus] |
Swiss-Prot | P17541 | 0 | 1 | 205 | 87 | 291 | CHIA_CUCSA RecName: Full=Acidic endochitinase; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2gsj_A | 0 | 3 | 205 | 64 | 271 | A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity |
PDB | 2hvm_A | 0 | 1 | 205 | 62 | 273 | A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity |
PDB | 1llo_A | 0 | 1 | 205 | 62 | 273 | A Chain A, Cdna Cloning And 1.75a Crystal Structure Determination Of Ppl2, A Novel Chimerolectin From Parkia Platycephala Seeds Exhibiting Endochitinolytic Activity |
PDB | 1hvq_A | 0 | 1 | 205 | 62 | 273 | A Chain A, Crystal Structures Of Hevamine, A Plant Defence Protein With Chitinase And Lysozyme Activity, And Its Complex With An Inhibitor |
PDB | 1kr0_A | 0 | 1 | 205 | 62 | 273 | A Chain A, Hevamine Mutant D125aY183F IN COMPLEX WITH TETRA-Nag |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JG492296 | 206 | 4 | 209 | 0 |
JG487511 | 178 | 1 | 178 | 0 |
JG484846 | 166 | 1 | 166 | 0 |
JG486676 | 163 | 1 | 163 | 0 |
JG480361 | 163 | 1 | 163 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|