Basic Information | |
---|---|
Species | Eucalyptus grandis |
Cazyme ID | Eucgr.A02711.1 |
Family | GT1 |
Protein Properties | Length: 113 Molecular Weight: 12415.5 Isoelectric Point: 8.7405 |
Chromosome | Chromosome/Scaffold: 1 Start: 37760768 End: 37761106 |
Description | UDP-glucosyl transferase 88A1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 7 | 100 | 1.8e-26 |
GSRREPRTGLVLKSWAPQVAVLSHDSVGGFLSHCGWNSVMEALIAGVPMIVWPLYAEQKLNRPYLAWYLKLVLPMSEGGSVTRDELAGQFTELM |
Full Sequence |
---|
Protein Sequence Length: 113 Download |
MRSFRVGSRR EPRTGLVLKS WAPQVAVLSH DSVGGFLSHC GWNSVMEALI AGVPMIVWPL 60 YAEQKLNRPY LAWYLKLVLP MSEGGSVTRD ELAGQFTELM LLDANCAIPK SP* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN00164 | PLN00164 | 3.0e-23 | 15 | 67 | 53 | + glucosyltransferase; Provisional | ||
PLN02534 | PLN02534 | 4.0e-24 | 15 | 67 | 53 | + UDP-glycosyltransferase | ||
PLN02863 | PLN02863 | 2.0e-24 | 5 | 98 | 96 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
PLN02167 | PLN02167 | 7.0e-25 | 15 | 100 | 92 | + UDP-glycosyltransferase family protein | ||
PLN03004 | PLN03004 | 5.0e-29 | 8 | 100 | 95 | + UDP-glycosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACB56924.1 | 3e-29 | 10 | 100 | 331 | 423 | glycosyltransferase UGT88A8 [Hieracium pilosella] |
GenBank | ACB56925.1 | 3e-29 | 15 | 100 | 338 | 425 | glycosyltransferase UGT88A9 [Hieracium pilosella] |
DDBJ | BAF75899.1 | 8e-34 | 15 | 103 | 342 | 432 | glucosyltransferase [Cyclamen persicum] |
RefSeq | XP_002274767.1 | 1e-29 | 9 | 108 | 330 | 431 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002274880.1 | 4e-29 | 10 | 108 | 337 | 437 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 7e-22 | 9 | 100 | 334 | 427 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2vch_A | 7e-22 | 9 | 100 | 334 | 427 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2vce_A | 7e-22 | 9 | 100 | 334 | 427 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2acw_B | 1e-18 | 21 | 67 | 339 | 385 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acw_A | 1e-18 | 21 | 67 | 339 | 385 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CD668483 | 96 | 8 | 101 | 2e-34 |
JG725109 | 103 | 8 | 108 | 5e-32 |
CO168485 | 101 | 10 | 108 | 1e-31 |
FN768657 | 101 | 10 | 108 | 2e-31 |
GE494728 | 97 | 9 | 103 | 3e-31 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|