Basic Information | |
---|---|
Species | Zea mays |
Cazyme ID | GRMZM2G081583_T01 |
Family | GH35 |
Protein Properties | Length: 140 Molecular Weight: 15381.9 Isoelectric Point: 9.3652 |
Chromosome | Chromosome/Scaffold: 4 Start: 67797673 End: 67799288 |
Description | beta-galactosidase 4 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 36 | 127 | 0 |
VINGQRRILISGSIHYPRSTPEMWPGLLQKAKDGGLDVVQTYVFWNGHEPVRGQYYFGDRYDLVRFVKLAKQAGLYVHLRIGPYVCAEWNFG |
Full Sequence |
---|
Protein Sequence Length: 140 Download |
MSGGAPLLAL LLLAAAAMIA PSPANAAVSY DHRAVVINGQ RRILISGSIH YPRSTPEMWP 60 GLLQKAKDGG LDVVQTYVFW NGHEPVRGQY YFGDRYDLVR FVKLAKQAGL YVHLRIGPYV 120 CAEWNFGWVF LLSFSPLSC* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam02449 | Glyco_hydro_42 | 0.008 | 50 | 115 | 67 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
COG1874 | LacA | 4.0e-15 | 28 | 124 | 99 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam01301 | Glyco_hydro_35 | 2.0e-56 | 36 | 127 | 92 | + Glycosyl hydrolases family 35. | ||
PLN03059 | PLN03059 | 1.0e-63 | 28 | 127 | 100 | + beta-galactosidase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0004565 | beta-galactosidase activity |
GO:0005975 | carbohydrate metabolic process |
GO:0009341 | beta-galactosidase complex |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
Swiss-Prot | A2X2H7 | 0 | 25 | 127 | 35 | 137 | BGAL4_ORYSI RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor |
GenBank | ACG30563.1 | 0 | 25 | 127 | 25 | 127 | beta-galactosidase precursor [Zea mays] |
RefSeq | NP_001130532.1 | 0 | 25 | 127 | 25 | 127 | hypothetical protein LOC100191631 [Zea mays] |
Swiss-Prot | Q6Z6K4 | 0 | 25 | 127 | 35 | 137 | BGAL4_ORYSJ RecName: Full=Beta-galactosidase 4; Short=Lactase 4; Flags: Precursor |
RefSeq | XP_002437187.1 | 0 | 26 | 127 | 29 | 130 | hypothetical protein SORBIDRAFT_10g022620 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3thd_D | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_C | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_B | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_A | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thc_D | 1e-21 | 28 | 127 | 11 | 110 | A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose |