Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01032021001 |
Family | GH1 |
Protein Properties | Length: 133 Molecular Weight: 14623.4 Isoelectric Point: 6.9423 |
Chromosome | Chromosome/Scaffold: 13 Start: 23467718 End: 23470754 |
Description | beta glucosidase 17 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 32 | 132 | 5.32493e-44 |
RSSFQAGFIFGTASASYQYEGAAKEGGRGPSIWDTFSHKYPERITDDSNDDVADDFCHRYKEDVHTMKELRLNAFRFSISWSRVLPRGKLSGGVNKEGIN F |
Full Sequence |
---|
Protein Sequence Length: 133 Download |
MAAHQCSLLL GLLILVGSVA WTEPVVAASF NRSSFQAGFI FGTASASYQY EGAAKEGGRG 60 PSIWDTFSHK YPERITDDSN DDVADDFCHR YKEDVHTMKE LRLNAFRFSI SWSRVLPRGK 120 LSGGVNKEGI NF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02849 | PLN02849 | 2.0e-29 | 27 | 132 | 106 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 4.0e-31 | 29 | 132 | 104 | + beta-glucosidase | ||
COG2723 | BglB | 5.0e-35 | 32 | 132 | 102 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
TIGR03356 | BGL | 7.0e-40 | 37 | 132 | 96 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 2.0e-40 | 34 | 132 | 99 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI24820.1 | 0 | 18 | 132 | 33 | 147 | unnamed protein product [Vitis vinifera] |
EMBL | CBI24830.1 | 0 | 16 | 132 | 548 | 664 | unnamed protein product [Vitis vinifera] |
EMBL | CBI24833.1 | 0 | 1 | 132 | 1 | 132 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002277198.1 | 0 | 1 | 132 | 1 | 132 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002277408.1 | 0 | 1 | 132 | 1 | 132 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1cbg_A | 1.4013e-45 | 28 | 132 | 12 | 116 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 4ek7_B | 3e-39 | 27 | 132 | 14 | 119 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 4ek7_A | 3e-39 | 27 | 132 | 14 | 119 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3u5y_B | 3e-39 | 27 | 132 | 14 | 119 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3u5y_A | 3e-39 | 27 | 132 | 14 | 119 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
tea aroma glycosidic precursor bioactivation | RXN-13691 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13692 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13693 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13694 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13695 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13696 | EC-3.2.1.149 | β-primeverosidase |
tea aroma glycosidic precursor bioactivation | RXN-13701 | EC-3.2.1.149 | β-primeverosidase |