Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma07g12701.1 |
Family | GH1 |
Protein Properties | Length: 116 Molecular Weight: 12941.2 Isoelectric Point: 6.5056 |
Chromosome | Chromosome/Scaffold: 07 Start: 11097425 End: 11098149 |
Description | beta glucosidase 8 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 1 | 101 | 6.4e-24 |
MHNMLLPHAKAIELYRKHFQAKQRGTIGIVAFSSMCDPLRDEECDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPMEMSLIKGSLDFIG M |
Full Sequence |
---|
Protein Sequence Length: 116 Download |
MHNMLLPHAK AIELYRKHFQ AKQRGTIGIV AFSSMCDPLR DEECDRQAVS RGLAFDIAWV 60 LDPLVFGEYP PEMRSILGSK MPVFSPMEMS LIKGSLDFIG MIGVPDYNLH IISAM* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
TIGR03356 | BGL | 1.0e-17 | 1 | 100 | 100 | + beta-galactosidase. | ||
PLN02998 | PLN02998 | 2.0e-20 | 1 | 102 | 106 | + beta-glucosidase | ||
pfam00232 | Glyco_hydro_1 | 3.0e-22 | 1 | 100 | 103 | + Glycosyl hydrolase family 1. | ||
PLN02849 | PLN02849 | 2.0e-25 | 2 | 102 | 101 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 2.0e-29 | 2 | 102 | 101 | + beta-glucosidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI20347.1 | 5e-37 | 1 | 101 | 234 | 334 | unnamed protein product [Vitis vinifera] |
GenBank | EEC77636.1 | 2e-32 | 2 | 101 | 193 | 292 | hypothetical protein OsI_16628 [Oryza sativa Indica Group] |
RefSeq | XP_002281979.1 | 2e-36 | 1 | 101 | 281 | 381 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002281986.1 | 9e-35 | 1 | 101 | 237 | 337 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002329151.1 | 2e-40 | 1 | 101 | 205 | 305 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2e40_B | 5e-23 | 2 | 112 | 202 | 309 | A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp |
PDB | 2e40_A | 5e-23 | 2 | 112 | 202 | 309 | A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp |
PDB | 2e3z_B | 5e-23 | 2 | 112 | 202 | 309 | A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form |
PDB | 2e3z_A | 5e-23 | 2 | 112 | 202 | 309 | A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form |
PDB | 2jf7_B | 1e-22 | 2 | 101 | 243 | 342 | A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FF547536 | 101 | 1 | 101 | 0 |
FK460141 | 78 | 6 | 83 | 1.4013e-45 |
FK474722 | 79 | 6 | 83 | 5.99994e-41 |
FC057498 | 97 | 1 | 97 | 4e-34 |
FK505710 | 83 | 3 | 84 | 6e-34 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Linum usitatissimum | Lus10043093.184.345 | Lus10043093.184.345 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|