Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10007208 |
Family | GH17 |
Protein Properties | Length: 145 Molecular Weight: 15167.4 Isoelectric Point: 8.8198 |
Chromosome | Chromosome/Scaffold: 674 Start: 171729 End: 172163 |
Description | beta-1,3-glucanase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH17 | 2 | 141 | 1.3e-37 |
ALQALKGNNIQLVLDVPNRVIPSLISDATVGVHTNILSYYPAVQFRYIVVGNEIGPDDPIAPSILPALTNINNILAANNAGSVKGSTTIKLVLLGTSYPP SAGALADSSSSFIIPIVQYLANNNAPLLANVYRFFAYIGN |
Full Sequence |
---|
Protein Sequence Length: 145 Download |
MALQALKGNN IQLVLDVPNR VIPSLISDAT VGVHTNILSY YPAVQFRYIV VGNEIGPDDP 60 IAPSILPALT NINNILAANN AGSVKGSTTI KLVLLGTSYP PSAGALADSS SSFIIPIVQY 120 LANNNAPLLA NVYRFFAYIG NSGR* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 3.0e-23 | 2 | 143 | 145 | + Glycosyl hydrolases family 17. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAS09871.1 | 3e-37 | 3 | 142 | 33 | 175 | endo-beta-1,3-glucanase [Glycine latrobeana] |
GenBank | AAS09877.1 | 5e-37 | 3 | 142 | 33 | 175 | endo-beta-1,3-glucanase [Glycine tabacina] |
GenBank | ACP43630.2 | 2e-36 | 2 | 144 | 32 | 178 | beta-1,3-glucanase [Musa AB Group] |
RefSeq | XP_002299791.1 | 9e-37 | 3 | 141 | 67 | 208 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002336706.1 | 7e-37 | 3 | 141 | 52 | 193 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2cyg_A | 4e-37 | 2 | 144 | 39 | 185 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_D | 6e-32 | 3 | 141 | 41 | 186 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_C | 6e-32 | 3 | 141 | 41 | 186 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_B | 6e-32 | 3 | 141 | 41 | 186 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_A | 6e-32 | 3 | 141 | 41 | 186 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GH270629 | 145 | 3 | 144 | 6e-24 |
BU868171 | 142 | 3 | 141 | 2e-22 |
DT473326 | 142 | 3 | 141 | 2e-22 |
DT476364 | 142 | 3 | 141 | 2e-22 |
CV240736 | 142 | 3 | 141 | 3e-22 |
Orthologous Group | |||||
---|---|---|---|---|---|
Species | ID | ||||
Fragaria vesca | mrna20137.1-v1.0-hybrid | ||||
Linum usitatissimum | Lus10007212 | ||||
Vitis vinifera | GSVIVT01031544001.129.203 | GSVIVT01031544001.129.203 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|