Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10417695g0010 |
Family | GT1 |
Protein Properties | Length: 90 Molecular Weight: 10264.7 Isoelectric Point: 4.9056 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 1 | 89 | 1e-26 |
MTHCGWNSTLESITLGVPMIAWPMFGDQHFNSKQVAEQFGTGVQFCEHRDGIPEEERVKEVVRLVLTEDEGEEMRRRAEKLKEMASKAV |
Full Sequence |
---|
Protein Sequence Length: 90 Download |
MTHCGWNSTL ESITLGVPMI AWPMFGDQHF NSKQVAEQFG TGVQFCEHRD GIPEEERVKE 60 VVRLVLTEDE GEEMRRRAEK LKEMASKAVA |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02534 | PLN02534 | 6.0e-16 | 1 | 89 | 101 | + UDP-glycosyltransferase | ||
PLN02863 | PLN02863 | 7.0e-17 | 1 | 89 | 89 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
PLN02152 | PLN02152 | 4.0e-17 | 1 | 88 | 88 | + indole-3-acetate beta-glucosyltransferase | ||
PLN02992 | PLN02992 | 1.0e-20 | 1 | 90 | 90 | + coniferyl-alcohol glucosyltransferase | ||
PLN02448 | PLN02448 | 3.0e-22 | 1 | 90 | 98 | + UDP-glycosyltransferase family protein |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK22917.1 | 0 | 1 | 90 | 197 | 286 | unknown [Picea sitchensis] |
GenBank | ABK24743.1 | 7e-21 | 1 | 89 | 378 | 464 | unknown [Picea sitchensis] |
GenBank | ABK24936.1 | 0 | 1 | 89 | 387 | 475 | unknown [Picea sitchensis] |
GenBank | ABR17572.1 | 6e-25 | 1 | 89 | 378 | 466 | unknown [Picea sitchensis] |
GenBank | ACN40348.1 | 1e-25 | 1 | 89 | 378 | 466 | unknown [Picea sitchensis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 6e-17 | 1 | 89 | 362 | 450 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 2vch_A | 6e-17 | 1 | 89 | 362 | 450 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 2vce_A | 6e-17 | 1 | 89 | 362 | 450 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2pq6_A | 0.000000000000008 | 1 | 87 | 376 | 458 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 3hbj_A | 0.00000000000001 | 1 | 89 | 350 | 435 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FD743489 | 89 | 1 | 89 | 1.99965e-42 |
HE622077 | 90 | 1 | 90 | 1.99965e-42 |
FD741938 | 89 | 1 | 89 | 3.00018e-42 |
HE634740 | 90 | 1 | 90 | 3.00018e-42 |
HE621785 | 89 | 1 | 89 | 3.00018e-42 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|