Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_16493g0020 |
Family | GT1 |
Protein Properties | Length: 107 Molecular Weight: 11578.5 Isoelectric Point: 4.7761 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 5 | 101 | 1.1e-21 |
QIAELATGLEGSGQRFFWVLRTSVVLSEGFVLSTVLPPCHCGWNSVVESVRCGVPIISWPLFGDHMMNTRLLVENAKGEDGVLSAEEVKRAVKCAME |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
MSVPQIAELA TGLEGSGQRF FWVLRTSVVL SEGFVLSTVL PPCHCGWNSV VESVRCGVPI 60 ISWPLFGDHM MNTRLLVENA KGEDGVLSAE EVKRAVKCAM ELEGGCI |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03004 | PLN03004 | 5.0e-16 | 2 | 106 | 145 | + UDP-glycosyltransferase | ||
PLN02554 | PLN02554 | 1.0e-16 | 5 | 101 | 149 | + UDP-glycosyltransferase family protein | ||
PLN02992 | PLN02992 | 2.0e-17 | 1 | 104 | 155 | + coniferyl-alcohol glucosyltransferase | ||
PLN00164 | PLN00164 | 1.0e-17 | 1 | 100 | 145 | + glucosyltransferase; Provisional | ||
PLN02448 | PLN02448 | 7.0e-19 | 1 | 103 | 133 | + UDP-glycosyltransferase family protein |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK25443.1 | 1e-18 | 1 | 105 | 284 | 427 | unknown [Picea sitchensis] |
GenBank | ACZ44839.1 | 2e-17 | 5 | 107 | 296 | 447 | glycosyltransferase [Malus x domestica] |
GenBank | ACZ44840.1 | 3e-16 | 5 | 107 | 298 | 449 | glycosyltransferase [Malus x domestica] |
GenBank | ACZ44842.1 | 6e-18 | 5 | 105 | 296 | 445 | glycosyltransferase [Pyrus communis] |
GenBank | EAZ22380.1 | 4e-18 | 1 | 101 | 190 | 293 | hypothetical protein OsJ_06038 [Oryza sativa Japonica Group] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 3e-17 | 5 | 105 | 285 | 432 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
PDB | 2vch_A | 3e-17 | 5 | 105 | 285 | 432 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
PDB | 2vce_A | 3e-17 | 5 | 105 | 285 | 432 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2acw_B | 0.00000000001 | 5 | 101 | 294 | 424 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acw_A | 0.00000000001 | 5 | 101 | 294 | 424 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |