| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_282591g0010 |
| Family | GH17 |
| Protein Properties | Length: 84 Molecular Weight: 9240.15 Isoelectric Point: 8.9545 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 83 | 1e-34 |
| MTNIQTAIQNANLRNNIKVSTAHAMSVIGNGFPPSQGAFRNDVKDTMSSILKFLSDNGAPFMANVYPYFSYIGNRNDISLDYA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 84 Download |
| MTNIQTAIQN ANLRNNIKVS TAHAMSVIGN GFPPSQGAFR NDVKDTMSSI LKFLSDNGAP 60 FMANVYPYFS YIGNRNDISL DYAX |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 4.0e-28 | 1 | 83 | 83 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB18242.1 | 1e-25 | 1 | 83 | 26 | 108 | beta-1,3-glucanase [Vitis vinifera] |
| GenBank | ABK23947.1 | 3e-36 | 1 | 83 | 138 | 219 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 2e-31 | 1 | 83 | 134 | 217 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 2e-32 | 1 | 83 | 142 | 223 | pollen allergen CJP38 [Cryptomeria japonica] |
| EMBL | CAM82809.1 | 8e-25 | 1 | 83 | 18 | 100 | pathogenesis-related protein 2 [Malus x domestica] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 8e-25 | 1 | 83 | 113 | 195 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
| PDB | 3f55_C | 8e-25 | 1 | 83 | 113 | 195 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
| PDB | 3f55_B | 8e-25 | 1 | 83 | 113 | 195 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
| PDB | 3f55_A | 8e-25 | 1 | 83 | 113 | 195 | A Chain A, Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes |
| PDB | 3em5_D | 8e-25 | 1 | 83 | 113 | 195 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO204728 | 83 | 1 | 83 | 1.00053e-42 |
| FY843834 | 83 | 1 | 83 | 3e-39 |
| CF667374 | 83 | 1 | 83 | 4e-39 |
| CF393164 | 83 | 1 | 83 | 2e-38 |
| CF391533 | 83 | 1 | 83 | 3e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_10431609g0020 | ||||
| Setaria italica | Si031068m | ||||
| Vitis vinifera | GSVIVT01015616001 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |