Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_5496494g0020 |
Family | GH35 |
Protein Properties | Length: 95 Molecular Weight: 10598.8 Isoelectric Point: 6.5143 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 1 | 76 | 3.7e-33 |
MWTENWAGWFQTFGGRTPHRPAEDVAFAVARFFQRGGTFQNYYIYHGGTNFGRTSGGPFITTSYDYDAPIDGYGRS |
Full Sequence |
---|
Protein Sequence Length: 95 Download |
MWTENWAGWF QTFGGRTPHR PAEDVAFAVA RFFQRGGTFQ NYYIYHGGTN FGRTSGGPFI 60 TTSYDYDAPI DGYGRSVSAA GIVTMLTTLE LVEKL |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam01301 | Glyco_hydro_35 | 1.0e-34 | 1 | 74 | 77 | + Glycosyl hydrolases family 35. | ||
PLN03059 | PLN03059 | 1.0e-38 | 1 | 74 | 74 | + beta-galactosidase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ83807.1 | 4.00001e-40 | 1 | 74 | 45 | 118 | unknown [Medicago truncatula] |
EMBL | CBI21600.1 | 7e-39 | 1 | 74 | 245 | 318 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002310540.1 | 5e-39 | 1 | 74 | 246 | 319 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002516237.1 | 8e-39 | 1 | 74 | 247 | 320 | beta-galactosidase, putative [Ricinus communis] |
RefSeq | XP_002522927.1 | 2e-39 | 1 | 74 | 251 | 324 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3d3a_A | 0.0000000002 | 1 | 75 | 236 | 314 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8d_B | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8d_A | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 4e8c_B | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
PDB | 4e8c_A | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |