| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_5496494g0020 |
| Family | GH35 |
| Protein Properties | Length: 95 Molecular Weight: 10598.8 Isoelectric Point: 6.5143 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 1 | 76 | 3.7e-33 |
| MWTENWAGWFQTFGGRTPHRPAEDVAFAVARFFQRGGTFQNYYIYHGGTNFGRTSGGPFITTSYDYDAPIDGYGRS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 95 Download |
| MWTENWAGWF QTFGGRTPHR PAEDVAFAVA RFFQRGGTFQ NYYIYHGGTN FGRTSGGPFI 60 TTSYDYDAPI DGYGRSVSAA GIVTMLTTLE LVEKL |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam01301 | Glyco_hydro_35 | 1.0e-34 | 1 | 74 | 77 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 1.0e-38 | 1 | 74 | 74 | + beta-galactosidase; Provisional | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACJ83807.1 | 4.00001e-40 | 1 | 74 | 45 | 118 | unknown [Medicago truncatula] |
| EMBL | CBI21600.1 | 7e-39 | 1 | 74 | 245 | 318 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002310540.1 | 5e-39 | 1 | 74 | 246 | 319 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002516237.1 | 8e-39 | 1 | 74 | 247 | 320 | beta-galactosidase, putative [Ricinus communis] |
| RefSeq | XP_002522927.1 | 2e-39 | 1 | 74 | 251 | 324 | beta-galactosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 0.0000000002 | 1 | 75 | 236 | 314 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.0000004 | 1 | 88 | 235 | 328 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Hydropathy |
|---|
 |
