| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_761919g0010 |
| Family | GH17 |
| Protein Properties | Length: 124 Molecular Weight: 13854.6 Isoelectric Point: 3.9106 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 2 | 113 | 4.2039e-45 |
| QISDTMKSILGFLDTTNSTLMINVYPYFSYMSDPTDISLDYALFNTTNPVVAGNLTYNNLFDAMVDAVLSAMETLGFPNLPIVITESGWPSSGNNVATVG NAQTYNNNFISY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 124 Download |
| PQISDTMKSI LGFLDTTNST LMINVYPYFS YMSDPTDISL DYALFNTTNP VVAGNLTYNN 60 LFDAMVDAVL SAMETLGFPN LPIVITESGW PSSGNNVATV GNAQTYNNNF ISYCYYRKWL 120 AFQR |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 8.0e-38 | 6 | 112 | 107 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABD85024.1 | 1e-30 | 4 | 114 | 177 | 288 | beta-1,3-glucanase [Lilium hybrid division VII] |
| GenBank | ABK23947.1 | 3e-36 | 3 | 113 | 179 | 290 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 9e-37 | 3 | 114 | 177 | 289 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 1.99993e-41 | 3 | 114 | 184 | 294 | pollen allergen CJP38 [Cryptomeria japonica] |
| EMBL | CAB91554.1 | 5e-30 | 1 | 114 | 182 | 296 | beta 1-3 glucanase [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ghs_B | 1e-26 | 7 | 114 | 149 | 258 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 1ghs_A | 1e-26 | 7 | 114 | 149 | 258 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 3f55_D | 2e-24 | 3 | 114 | 155 | 267 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 3f55_C | 2e-24 | 3 | 114 | 155 | 267 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| PDB | 3f55_B | 2e-24 | 3 | 114 | 155 | 267 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GW745670 | 113 | 3 | 114 | 8.99999e-40 |
| DR017905 | 113 | 3 | 114 | 2e-39 |
| GW768675 | 113 | 3 | 114 | 2e-39 |
| DR161288 | 113 | 3 | 114 | 3e-39 |
| DR098597 | 113 | 3 | 114 | 3e-39 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Arabidopsis lyrata | 326432.178.280 | 326432.178.280 | |||
| Fragaria vesca | mrna12481.1-v1.0-hybrid | ||||
| Picea abies | MA_9530584g0010 | MA_1673060g0010 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |