| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_98310g0010 |
| Family | GH17 |
| Protein Properties | Length: 109 Molecular Weight: 11910.7 Isoelectric Point: 8.883 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 5 | 109 | 1.1e-35 |
| KDSFVAAMEALGFPDVKVAISETGWPTAGGPDEVGASVSNAGLYNGRLVQKMMMNPPKGTPRRPGAYIPTFIFALFNENQKPGPVTERNWGLLYPNASHV YPLSF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 109 Download |
| MFYIKDSFVA AMEALGFPDV KVAISETGWP TAGGPDEVGA SVSNAGLYNG RLVQKMMMNP 60 PKGTPRRPGA YIPTFIFALF NENQKPGPVT ERNWGLLYPN ASHVYPLSF |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-36 | 6 | 109 | 104 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABR16205.1 | 2e-38 | 6 | 107 | 269 | 370 | unknown [Picea sitchensis] |
| RefSeq | XP_001762206.1 | 6e-37 | 6 | 109 | 231 | 334 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001764817.1 | 1e-36 | 6 | 105 | 219 | 318 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001775379.1 | 3e-38 | 6 | 107 | 219 | 320 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_001779924.1 | 6e-40 | 6 | 109 | 259 | 362 | predicted protein [Physcomitrella patens subsp. patens] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ghr_A | 4e-24 | 6 | 109 | 212 | 306 | A Chain A, Crystal Structure Of Complex Xylanase 10b From Thermotoga Maritima With Xylobiose |
| PDB | 1aq0_B | 4e-24 | 6 | 109 | 212 | 306 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 4e-24 | 6 | 109 | 212 | 306 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 2cyg_A | 2e-20 | 4 | 109 | 214 | 312 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghs_B | 5e-20 | 6 | 109 | 211 | 306 | A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CO473442 | 104 | 6 | 109 | 0 |
| DR569014 | 104 | 6 | 109 | 0 |
| DR561885 | 104 | 6 | 109 | 0 |
| DR570385 | 104 | 6 | 109 | 0 |
| DR566821 | 104 | 6 | 109 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_10434158g0010.166.271 | MA_10434158g0010.166.271 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |