Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_9955818g0010 |
Family | CE10 |
Protein Properties | Length: 154 Molecular Weight: 16909.3 Isoelectric Point: 6.0912 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 31 | 136 | 1.9e-34 |
APFEDDGRVLSKDVVFEPSLGLELRLYIPALVVTTKLPIFVYFHGGGFCIGSRTWPNFHNYCLRLAASLNAIVVAPDYRLGPEHRLPDALDDGFSALRWI RAQAAA |
Full Sequence |
---|
Protein Sequence Length: 154 Download |
MEATVVEDCR GVLQVYSNGT ITRSQKPSFV APFEDDGRVL SKDVVFEPSL GLELRLYIPA 60 LVVTTKLPIF VYFHGGGFCI GSRTWPNFHN YCLRLAASLN AIVVAPDYRL GPEHRLPDAL 120 DDGFSALRWI RAQAAAAGSS AAEPWLADHA DFAR |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00312 | Esterase_lipase | 1.0e-7 | 52 | 112 | 62 | + Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate. | ||
pfam00135 | COesterase | 7.0e-8 | 66 | 112 | 47 | + Carboxylesterase family. | ||
COG2272 | PnbA | 4.0e-9 | 51 | 113 | 63 | + Carboxylesterase type B [Lipid metabolism] | ||
COG0657 | Aes | 1.0e-16 | 23 | 122 | 101 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 4.0e-21 | 70 | 124 | 55 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABB89016.1 | 0 | 6 | 154 | 15 | 159 | CXE carboxylesterase [Actinidia deliciosa] |
GenBank | ABK22844.1 | 0 | 1 | 154 | 1 | 154 | unknown [Picea sitchensis] |
EMBL | CAN74724.1 | 0 | 6 | 154 | 7 | 151 | hypothetical protein [Vitis vinifera] |
EMBL | CBI24401.1 | 0 | 6 | 154 | 24 | 168 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002277507.1 | 0 | 6 | 154 | 7 | 151 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 2e-23 | 20 | 154 | 31 | 162 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2o7r_A | 2e-23 | 20 | 154 | 31 | 162 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3zwq_B | 0.0000000000003 | 66 | 154 | 75 | 171 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3zwq_A | 0.0000000000003 | 66 | 154 | 75 | 171 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2yh2_D | 0.0000000000003 | 66 | 154 | 75 | 171 | A Chain A, Pyrobaculum Calidifontis Esterase Monoclinic Form |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR451125 | 154 | 1 | 154 | 0 |
FD741803 | 154 | 1 | 154 | 0 |
DR525103 | 154 | 1 | 154 | 0 |
CO162465 | 156 | 1 | 154 | 0 |
CO414211 | 156 | 1 | 154 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|