Basic Information | |
---|---|
Species | Malus domestica |
Cazyme ID | MDP0000816142 |
Family | CE10 |
Protein Properties | Length: 164 Molecular Weight: 17611.1 Isoelectric Point: 4.4008 |
Chromosome | Chromosome/Scaffold: 0415586 Start: 13324 End: 13815 |
Description | alpha/beta-Hydrolases superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 46 | 163 | 1.6e-30 |
SKNIVILPQTGVSAQLYRPITTKLGTKLPLVVYLHGGAFCISSATDPYYHTSLNNLVAEANAIAILVNYRLAPEYPLPIAYEDCWAASNWVINGDEDRDS GVKDDVDFSRVFLVGDSA |
Full Sequence |
---|
Protein Sequence Length: 164 Download |
MAATTSPKVL LEVFPYLQVL KDGTIDRLTG TQVAPPGLDP ETGVLSKNIV ILPQTGVSAQ 60 LYRPITTKLG TKLPLVVYLH GGAFCISSAT DPYYHTSLNN LVAEANAIAI LVNYRLAPEY 120 PLPIAYEDCW AASNWVINGD EDRDSGVKDD VDFSRVFLVG DSA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00135 | COesterase | 3.0e-7 | 62 | 118 | 57 | + Carboxylesterase family. | ||
cd00312 | Esterase_lipase | 2.0e-7 | 61 | 118 | 60 | + Esterases and lipases (includes fungal lipases, cholinesterases, etc.) These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These catalytic residues are responsible for the nucleophilic attack on the carbonyl carbon atom of the ester bond. In contrast with other alpha/beta hydrolase fold family members, p-nitrobenzyl esterase and acetylcholine esterase have a Glu instead of Asp at the active site carboxylate. | ||
COG2272 | PnbA | 2.0e-8 | 70 | 119 | 50 | + Carboxylesterase type B [Lipid metabolism] | ||
COG0657 | Aes | 1.0e-20 | 2 | 163 | 165 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 2.0e-27 | 76 | 163 | 88 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016787 | hydrolase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAM61103.1 | 0 | 4 | 163 | 3 | 159 | unknown [Arabidopsis thaliana] |
GenBank | ABB89003.1 | 0 | 1 | 163 | 1 | 163 | CXE carboxylesterase [Malus pumila] |
GenBank | ACU20935.1 | 0 | 1 | 163 | 1 | 168 | unknown [Glycine max] |
RefSeq | XP_002284585.1 | 0 | 4 | 163 | 3 | 165 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002327124.1 | 0 | 6 | 162 | 4 | 163 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 4e-18 | 31 | 163 | 40 | 170 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2o7r_A | 4e-18 | 31 | 163 | 40 | 170 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2zsi_A | 9e-16 | 22 | 163 | 45 | 199 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 2zsh_A | 9e-16 | 22 | 163 | 45 | 199 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
PDB | 3ed1_F | 0.000000000000002 | 22 | 163 | 37 | 198 | B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EB138491 | 163 | 1 | 163 | 0 |
ES789964 | 163 | 1 | 163 | 0 |
EG631244 | 163 | 1 | 163 | 0 |
FC863223 | 164 | 1 | 163 | 0 |
DC653225 | 161 | 5 | 163 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|