| Basic Information | |
|---|---|
| Species | Carica papaya |
| Cazyme ID | evm.model.supercontig_49.127 |
| Family | GH17 |
| Protein Properties | Length: 100 Molecular Weight: 11556.1 Isoelectric Point: 4.7588 |
| Chromosome | Chromosome/Scaffold: 49 Start: 965840 End: 966139 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 98 | 7.7e-32 |
| MVDAFNAALEKVNFENVKIVISETGWPSDGNPPFTSIENIATYDKKFYFHISHKGTPRKPDALVDAFFFEMFNEDLKPNPVEQHFGFFYPNMQPVYPF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 100 Download |
| MVDAFNAALE KVNFENVKIV ISETGWPSDG NPPFTSIENI ATYDKKFYFH ISHKGTPRKP 60 DALVDAFFFE MFNEDLKPNP VEQHFGFFYP NMQPVYPFW* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG5309 | COG5309 | 4.0e-8 | 16 | 91 | 84 | + Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-31 | 1 | 98 | 99 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN05913.1 | 7e-29 | 1 | 98 | 237 | 335 | Glycoside hydrolase, family 17 [Medicago truncatula] |
| RefSeq | NP_177901.1 | 6e-31 | 2 | 99 | 235 | 333 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | NP_177902.1 | 5e-26 | 1 | 96 | 241 | 339 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002302261.1 | 7e-34 | 1 | 99 | 218 | 317 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002306606.1 | 6e-35 | 1 | 99 | 211 | 309 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 5e-21 | 1 | 96 | 214 | 308 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ghr_A | 1e-19 | 2 | 97 | 211 | 303 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1aq0_B | 1e-19 | 2 | 97 | 211 | 303 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 1aq0_A | 1e-19 | 2 | 97 | 211 | 303 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| PDB | 3ur8_B | 2e-17 | 1 | 98 | 214 | 312 | A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JK804435 | 100 | 1 | 100 | 2e-38 |
| JK809880 | 100 | 1 | 100 | 3e-38 |
| JK804836 | 100 | 1 | 100 | 3e-38 |
| JG451228 | 100 | 1 | 100 | 3e-38 |
| JK802300 | 100 | 1 | 100 | 3e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Brassica rapa | Bra003668 | ||||
| Carica papaya | evm.model.supercontig_49.128.179.264 | evm.model.supercontig_49.128.179.264 | |||
| Cucumis sativus | Cucsa.141670.1 | Cucsa.142770.1 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |