| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g044734m |
| Family | CE8 |
| Protein Properties | Length: 130 Molecular Weight: 14372.2 Isoelectric Point: 4.7686 |
| Chromosome | Chromosome/Scaffold: 04274 Start: 6560 End: 6949 |
| Description | Plant invertase/pectin methylesterase inhibitor superfamily |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE8 | 1 | 120 | 0 |
| VSGDRFLARDLTIENKAGPEKYQAVALRVNADFAALFRCSFSGYQDTLYAHSFRQFYRECDVYGTIDYIFGNAAVVLQACNIVSRLPLPGQFTVITAQLK DDPNENTGISIQNCSILATE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 130 Download |
| VSGDRFLARD LTIENKAGPE KYQAVALRVN ADFAALFRCS FSGYQDTLYA HSFRQFYREC 60 DVYGTIDYIF GNAAVVLQAC NIVSRLPLPG QFTVITAQLK DDPNENTGIS IQNCSILATE 120 DLYANSASVK |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02314 | PLN02314 | 9.0e-59 | 1 | 124 | 124 | + pectinesterase | ||
| PLN03043 | PLN03043 | 2.0e-61 | 1 | 128 | 128 | + Probable pectinesterase/pectinesterase inhibitor; Provisional | ||
| PLN02713 | PLN02713 | 2.0e-64 | 1 | 130 | 130 | + Probable pectinesterase/pectinesterase inhibitor | ||
| pfam01095 | Pectinesterase | 2.0e-79 | 1 | 130 | 130 | + Pectinesterase. | ||
| PLN02416 | PLN02416 | 6.0e-81 | 1 | 130 | 130 | + probable pectinesterase/pectinesterase inhibitor | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN08348.1 | 0 | 1 | 130 | 307 | 436 | Pectinesterase; Pectinesterase inhibitor [Medicago truncatula] |
| DDBJ | BAH56489.1 | 0 | 1 | 130 | 316 | 445 | pectin methylesterase 1 [Prunus persica] |
| RefSeq | NP_180212.1 | 0 | 1 | 130 | 320 | 449 | pectinesterase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002326320.1 | 0 | 1 | 130 | 310 | 439 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002516192.1 | 0 | 1 | 130 | 316 | 445 | Pectinesterase PPE8B precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 6.99949e-42 | 3 | 122 | 93 | 212 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 9.99995e-41 | 3 | 122 | 89 | 208 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_B | 0.0000000001 | 23 | 121 | 129 | 232 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntq_A | 0.0000000001 | 23 | 121 | 129 | 232 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 2ntp_B | 0.0000000001 | 23 | 121 | 129 | 232 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Hydropathy |
|---|
 |
