Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000841545.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Bacillus phage Bam35c	NC_005258.1	NP_943747.1	358	534	+	59	5.5	10.4288	AcrVA1-0-SRS2267655\|NODE_151_length_6493_cov_11.540230_13\|HTH_17\|34.0\|1.8e-06	0.360732137	6	-2.6999822	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_Bam35c_NC_005258-gi\|38640277\|ref\|NP_943747.1\|\|2.93e-35	-	MSKLLTAQEVADLLRVHKKTIHRMIHSGKLDASKVANKFLIKEEDAKGLLENKNKLDN	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus Bam35
Acr-Aca 1	Low Confidence	Bacillus phage Bam35c	NC_005258.1	NP_943748.1	550	1053	+	168	-6.5	4.6333	Acr	0.342548222	8	-3.2186124	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_Bam35c_NC_005258-gi\|38640278\|ref\|NP_943748.1\|\|3.21e-121	-	MENNTKQLNNEVNEIAVVEETINTNDIMTVDKVTPSIFEAEGSKEVFFSSIQKTDRKSAVKMYNAINSSENALSDHTGEVLQITDMVAHAITLEDEQTKENVDALRVVLLDKDGKGYHAVSQGVVSSIQKIISIVGPAPWTDEPLKIVPYEVKTRKGFKTLTLQLQG	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus Bam35
Acr-Aca 1	Low Confidence	Bacillus phage Bam35c	NC_005258.1	NP_943749.1	1125	1349	+	75	-3.5	4.5338	Acr	0.606417954	2	-0.7764652	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_Bam35c_NC_005258-gi\|38640279\|ref\|NP_943749.1\|\|1.37e-47	-	MNAIKNLVQVSIRTNERELEFVSFNGMVHLKQKLEDDETSVVLTKEELDVVAAMSNFDNVIANFMNSITEKKTM	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus Bam35

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder