Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000843085.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Streptomyces virus phiBT1	NC_004664.2	NP_813700.1	7299	7730	+	144	19	11.1899	Acr	0.154252715	13	-3.9040742	Not found in Prophage	Not found in Prophage	PHAGE_Strept_phiBT1_NC_004664-gi\|29366760\|ref\|NP_813700.1\|\|1.41e-100	-	MAQRSAYTIRVDGLREFQRNVRTLRDKELNKAVREANKASGEVLIPQAKHESPDGKRDAKSSKKYRPGKLDKSIKVTASAKGAVIKAGSASRVPYAAAIHFGYRARNISPNRFLFRAMARKSDVVAATYERRIAAVVEKYLES	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Lomovskayavirus; Streptomyces virus phiBT1
Acr-Aca 1	Low Confidence	Streptomyces virus phiBT1	NC_004664.2	NP_813701.1	7730	8011	+	94	0	6.3584	AcrIIA9-1-WP_118548094.1\|HTH_26\|42.3\|0.0026	0.290568185	26	-4.5016747	Not found in Prophage	Not found in Prophage	PHAGE_Strept_phiBT1_NC_004664-gi\|29366761\|ref\|NP_813701.1\|\|4.49e-62	-	MPAKKPAFEMPEDFTLDLKLDSLTIDEIDAIEEITGAPLDSLNKAGTRRAPMLRAMAYVVMKRKFPEIEPADVGRLKLNLKGKGKPDPTATNA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Lomovskayavirus; Streptomyces virus phiBT1

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder