Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000843545.1 (Total 2 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pseudomonas phage PaP2	NC_005884.1	YP_024733.1	2269	2853	+	195	-4	4.9144	WP_003442424.1\|HTH_XRE\|AcrIIA15\|43.8\|5.7e-05	0.29207382	47	-5.176242	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_PaP2_NC_005884-gi\|48697075\|ref\|YP_024733.1\|\|6.35e-142	-	MDKKERIARLLATGLKAAQVADLVAVSPSYISQLLTSDSDFRDYVTYLRTESAEETGQPTEAEALELKYEAAEHTALKALLERLPMMEDKNLLTAVQVLSNRRQQEAKAKLLAKGIGYGGSATQVVVDGKSVKVTHLQIPAVCAPDFTYSDTKEIVAIGDRSTNPMPTPQLKGLLESYLGKADPSGVPNYDSFD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage PaP2
Acr-Aca 1	Low Confidence	Pseudomonas phage PaP2	NC_005884.1	YP_024734.1	2837	2983	+	49	5.5	11.8222	Acr	0.238167229	24	-4.043697	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_PaP2_NC_005884-gi\|48697076\|ref\|YP_024734.1\|\|4.97e-28	-	MTHSTNLTQVNQSKTAAMAKAASMAKLLASSQPKFPFFPLRMAANERS	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage PaP2
Acr-Aca 2	Low Confidence	Pseudomonas phage PaP2	NC_005884.1	YP_024770.1	35034	35345	-	104	3	8.0499	7000000492_____SRS048164_WUGC_scaffold_41429_9\|HTH_19\|AcrIIA1\|44.8\|0.007	0.691418602	5	-2.015925	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_PaP2_NC_005884-gi\|48697112\|ref\|YP_024770.1\|\|2.68e-74	-	MTNYNFQNPIRLEICKDGKSYNMRSLWVHYYAKHHRFAKGYLSNLTRLVRDFGEVFEPSDLEKIEEALEILDAELLKAIKTKYEAHKAFLIRQGVRLNWDSET	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage PaP2
Acr-Aca 2	Low Confidence	Pseudomonas phage PaP2	NC_005884.1	YP_024771.1	35342	35527	-	62	-4	4.5659	Acr	0.578093273	2	-1.1160145	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_PaP2_NC_005884-gi\|48697113\|ref\|YP_024771.1\|\|9.84e-41	-	MNFSKQFEEEGGFDLVYHWSDDPTVIVEKFNSPGDRADRWAELRGLENPREGHILKAGEPK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; UNKNOWN_genus; Pseudomonas phage PaP2

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder