Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000859725.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Bacillus phage GIL16c	NC_006945.1	YP_224099.1	355	531	+	59	5.5	10.4288	AcrVA1-0-SRS2267655\|NODE_151_length_6493_cov_11.540230_13\|HTH_17\|34.0\|1.8e-06	0.280270618	6	-2.4908242	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_GIL16c_NC_006945-gi\|62327520\|ref\|YP_224099.1\|\|1.40e-35	-	MSKLLTAQEVADLLRVHKKTIHRMIHSGKLDASKVANKFLIKEEDAKGLLENKNKMDN	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus GIL16
Acr-Aca 1	Low Confidence	Bacillus phage GIL16c	NC_006945.1	YP_224100.1	547	1047	+	167	-6	4.7319	Acr	0.346679537	8	-3.0970411	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_GIL16c_NC_006945-gi\|62327521\|ref\|YP_224100.1\|\|2.35e-119	-	MENNTKQLNNEVNEIAVVDEHVNTNDIVTVDKVSPSIFEADGAKDVFFSSIQSKDRKSAIKVYNAINSSENALADHRGEVLEITDMVAHAITLQDELTKEDVDALRVVLIDKNGKAYHAVSQGVVSSIQKIISIVGPAPWNEPLEIVPAEVKTRKGFKTLTLQLQG	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus GIL16
Acr-Aca 1	Low Confidence	Bacillus phage GIL16c	NC_006945.1	YP_224101.1	1119	1343	+	75	-3.5	4.5489	Acr	0.599908698	3	-0.627406	Not found in Prophage	Not found in Prophage	PHAGE_Bacill_GIL16c_NC_006945-gi\|62327522\|ref\|YP_224101.1\|\|1.90e-47	-	MNAIKNLVQVSIRTNERELEFVSFNGMVHLKQKLEEDETSVVLTKEELDMVAAMSNFDNVIANFMNSITEKKAM	No	No	Viruses; Preplasmiviricota; Tectiliviricetes; Kalamavirales; Tectiviridae; Betatectivirus; Bacillus virus GIL16

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder