Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000863885.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Stenotrophomonas phage SMA9	NC_007189.1	YP_257147.1	1702	2184	+	161	7.5	9.5881	WP_113131921.1\|HTH_37\|AcrIIA15\|48.5\|1.9e-05	0.085085357	2	-4.7356825	Not found in Prophage	Not found in Prophage	PHAGE_Stenot_phiSMA9_NC_007189-gi\|70727680\|ref\|YP_257147.1\|\|1.01e-116	-	MSASYDLFCRWKHVQKIQSDNAGALALGVSRATVSLWKQGKNAKIHYIERMAVDIGDSPEMWSAVVMAERSNSEDEKAAWRRIAQKLATVVMALCLFVGAALPHDVQAMPQAGNALHDIHYAKSRIRRIWAFVGSAWQWLGLWLGSCLRPQSPAKDEIAA	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Staminivirus; Stenotrophomonas virus SMA9
Acr-Aca 1	Low Confidence	Stenotrophomonas phage SMA9	NC_007189.1	YP_257148.1	2181	2561	+	127	1	7.1695	Acr	0.137478741	4	-5.1512823	Not found in Prophage	Not found in Prophage	PHAGE_Stenot_phiSMA9_NC_007189-gi\|70727681\|ref\|YP_257148.1\|\|1.82e-88	-	MIEFDPHHRIDLTGPWAGFSFLGDRLITPEGRELLPEDLAWLSLTACQAQEWRRMMEAARSVPSIDSSKRGGNLPAVTWDRPATVVNLRDVVSRRKQRSAVAMAGPDAEPPAVDLPILGPMPRQRV	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Staminivirus; Stenotrophomonas virus SMA9

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder