Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000867405.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Cooper	NC_008195.1	YP_654937.1	37892	38176	-	95	11.5	12.2122	Acr	0.284791138	46	-4.878461	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Cooper_NC_008195-gi\|109392393\|ref\|YP_654937.1\|\|6.09e-65	-	MTRHARRCSRPVTVALMGGTGVLLLAASFFNTNPHPGISAAIGAALIGGWSWLRYRDNRELASVKVIQRRAEPTRAKELLGTFHDHPHRAVRGA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Coopervirus; Mycobacterium virus Cooper
Acr-Aca 1	Low Confidence	Mycobacterium phage Cooper	NC_008195.1	YP_654938.1	38176	38382	-	69	5.5	10.8035	Acr	0.190590823	13	-3.8289266	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_ChrisnMich_NC_042034-gi\|100040\|ref\|YP_009614363.1\|\|4.96e-45	-	MTTTERQVQKYLSRQDVAKRLGMKSVRSLSGIDLPPHDVEVGRHKGWLPETIDAWHAERPGRGWWGGR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Coopervirus; Mycobacterium virus Cooper
Acr-Aca 1	Low Confidence	Mycobacterium phage Cooper	NC_008195.1	YP_654939.1	38379	38807	-	143	-4	4.8212	AcrIIA4-0-WP_115856875.1\|HTH_19\|30.0\|0.0065	0.172327456	24	-4.3782134	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Cooper_NC_008195-gi\|109392395\|ref\|YP_654939.1\|\|1.21e-102	-	MTTVTELPAAPQPTEHVYGLGELIRNFRLYIGLDQRSMALKLGKPRRDYQRIESGADKCPPGMLTAVENLVDEFDDNVARVIEAAEADPDRHVNIAVETGGQWEWERLVAGRAAVIVAGDPTLPRIDLTMSGNSTARERSIR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Coopervirus; Mycobacterium virus Cooper

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder