Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000870305.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Staphylococcus phage phiNM3	NC_008617.1	YP_908796.1	4246	4509	+	88	2	9.333	WP_029188634.1\|HTH_3-0-AcrIIA1\|60.6\|3.5e-19	0.411502575	41	-3.5545225	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_StauST398_2_NC_021323-gi\|509139885\|ref\|YP_008058771.1\|\|1.29e-57	-	MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDIFLGNEYENFVFTNDKKKSIILAFKEKQTS	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Biseptimavirus; Staphylococcus phage phiNM3
Acr-Aca 1	Low Confidence	Staphylococcus phage phiNM3	NC_008617.1	YP_908797.1	4525	4740	+	72	3.5	9.5239	Acr	0.435923223	27	-2.588339	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_phiNM3_NC_008617-gi\|118725061\|ref\|YP_908797.1\|\|1.33e-48	-	MNIQVATKLAMEKGISIRRENQDVYGILPTNLQRYQCLVVSRHYKKKRQTAAGRWQPSADDLIADDWILDY	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Biseptimavirus; Staphylococcus phage phiNM3

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder