Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000875405.1 (Total 4 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994739.1	4494	4751	+	86	0.5	7.0104	Acr	0.339871243	28	-3.8859248	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_BBPiebs31_NC_042327-gi\|100009\|ref\|YP_009637538.1\|\|2.39e-55	-	MNRLITMFAAALVKAVFDYLRAHPEFLNQVIDRATAKMPDLADLDDKILAKIPDLSRLDDKIIGLFPDLSRLPEQLINAINPFKR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 1	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994740.1	4751	5332	+	194	17.5	10.1549	WP_118999725.1\|HTH_Tnp_ISL3\|AcrIIA15\|34.2\|1.1e-10	0.082379696	39	-4.1337414	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_DD5_NC_011022-gi\|192823822\|ref\|YP_001994740.1\|\|7.44e-145	-	MQWRPVVGHEGKYLVSDEGQILSLITGKTLRPGTMVSGHRYVTIARPSRTALVHTLVMEAFVGPRPEGYEIRHLNGDPDDNRLENLQYGTRSENAEDSKVHGTHFHAGLTHCKRGHELSGDNLQNHSGTNRRTCLACRRKRQALYDSGQRVTKEGFCINGHPKTPENRYTNGVGRSRCKPCVQERRKTRKEAA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 1	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994738.1	4226	4486	+	87	-7	4.3253	Acr	0.212715153	12	-2.836916	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_DD5_NC_011022-gi\|192823820\|ref\|YP_001994738.1\|\|1.16e-57	-	MTTVTATVHDISGRPDDSHWTFSSDLREQDGVIITPRVVRVKPFNGELALTLPPGPVRVAHHQDRWLIDVPEEDSDLWDLIEAATD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 2	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994748.1	13374	13610	+	79	-8.5	3.9147	AcrIE2-0-WP_109422150.1\|HTH_23\|46.4\|0.0079	0.445510414	19	-3.1771603	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_BBPiebs31_NC_042327-gi\|100017\|ref\|YP_009637546.1\|\|3.46e-51	-	MTHPYNGAVVRGWLGSLSDSEIVAKLTDLTGFAPAAMDEDYEPAAAPAAVAADDTVQEAIAKLEKRLADLESTVEGMA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 2	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994749.1	13610	14059	+	150	-12	4.1549	Acr	0.126832135	11	-2.6281445	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Marcell_NC_041853-gi\|100017\|ref\|YP_009591857.1\|\|3.34e-107	-	MAYAEPSDVVARLGRPLTDDEETQVETFLEDAEIEIRSRIPDLDDKAEDEDYLKRVIKVEASAVTRLIRNPDGYIGETDGNYSYQLNWRLNTGAIEITDKEWAQLGLSKNVGVLNVRPKTPLERSGEYPAFGSVEWQVFQQSSPLYWGY	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 2	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994750.1	14059	14421	+	121	2	9.364	Acr	0.308157529	29	-3.97548	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_DD5_NC_011022-gi\|192823832\|ref\|YP_001994750.1\|\|3.45e-84	-	MSGLLDDGANYEPVTVYPEVTRKDRLGNTLVGPSATGIETVARFQVQNQSGTSARRAELDDIGDMTEQVYTMRLPRSFTTELKSGSEVVWRGERWGVYGEPRRYNGSRRTARLEYVVRRF	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 2	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994751.1	14421	14816	+	132	5.5	9.5604	Acr	0.245537067	55	-4.812358	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_BBPiebs31_NC_042327-gi\|100020\|ref\|YP_009637549.1\|\|1.05e-94	-	MPLYYGRSGLNKVVSHLPGVVHEMRSEADEVADRAKANLAAARASTQWEKIHGPDHLTKITRTNGSVDAYVNMEAPSPESIEYGHYPSGVFDPEKYGRVTKAPQGLYILTGAAGFGGQTAISTGAKRGKRG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 2	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994752.1	14820	15266	+	149	1.5	6.9898	Acr	0.161742151	67	-5.2207713	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Papez_NC_031041-gi\|100022\|ref\|YP_009283269.1\|\|8.70e-106	-	MAGKLPIVGEVVLPILRGHEDLSNPISTVPSLTGVHVGTWVEDIDSRTFPLITVRRVGGTRSPEHPTLFTQPVVEMTAYSAADLPTTEQMYEDALEVLYRAARLQTKTPAGYLHSVTETLGASHGPSPFDRTWRVFGLIRLGIRPPKN	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 3	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994794.1	42829	42996	-	56	-9	3.9638	Acr	0.192947234	35	-4.0490904	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_DD5_NC_011022-gi\|192823876\|ref\|YP_001994794.1\|\|6.72e-35	-	MPQTVHVLPVDDLIEHEDIGGDCVCGPEIEPVFDADGACGWVITHHSLDGRERFE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5
Acr-Aca 3	Low Confidence	Mycobacterium phage DD5	NC_011022.1	YP_001994799.1	43899	44204	-	102	6.5	10.8762	AcrIIA7-0-WP_106317108.1\|HTH_DeoR\|48.4\|0.0023	0.247893563	38	-4.117839	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_DD5_NC_011022-gi\|192823881\|ref\|YP_001994799.1\|\|1.07e-69	-	MGGRAVPPTLRVVRTSERGYERPLQSTSQQAAGSVRDQGAVVSNPSLATEEQLTELFGVDTDTVRRWRKQGLAAVGDYSPKWGKPTPLFSVASAARYHRKG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fromanvirus; Mycobacterium phage DD5

Showing 1 to 10 of 19 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder