Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000880555.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Spud	NC_011270.1	YP_002224316.1	20523	20834	+	104	-5.5	4.6229	Acr	0.602479973	158	-5.097202	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Lukilu_NC_041901-gi\|100055\|ref\|YP_009597658.1\|\|2.32e-72	-	MGAQLTPDELAGAAMRPRYQQLTPVIDYEAALRRFLAEELPPDTIFDAEHLNLGLQLVIEFNRDIWQHRVPSTWEMVLADRAGRLEEHIAEIEAEYQRSKEKK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Bxz1
Acr-Aca 1	Low Confidence	Mycobacterium phage Spud	NC_011270.1	YP_002224317.1	20831	21037	+	69	1.5	7.3193	Rampelli_10023_NODE_1391_length_7026_cov_4.689715_4\|HTH_XRE-1-AcrIIA15\|39.6\|7.8e-06	0.528509491	63	-3.6784687	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Sebata_NC_041993-gi\|100065\|ref\|YP_009608750.1\|\|1.22e-44	-	MTTSVVHNQLQVELIHKVTEGMEANGWSQGDLERHSGVAQPNISNLLSGKRLGTLSTWNKLLRAVEAP	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Bxz1
Acr-Aca 1	Low Confidence	Mycobacterium phage Spud	NC_011270.1	YP_002224318.1	21034	21342	+	103	0	6.4607	Acr	0.338416214	157	-5.074793	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Lukilu_NC_041901-gi\|100057\|ref\|YP_009597660.1\|\|1.57e-71	-	MSGLTPTQELVLEVLAARTRLGEQAWTFLSRPAVVSAAKALDERGLVWWKYASTPHAILVGLTDQGKLACIDPGYVPPVERTDREAIRKRMHEMIDNVLDGV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Bxz1
Acr-Aca 1	Low Confidence	Mycobacterium phage Spud	NC_011270.1	YP_002224319.1	21345	21677	+	111	7	10.3323	Acr	0.454546078	141	-4.906878	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Sebata_NC_041993-gi\|100067\|ref\|YP_009608752.1\|\|1.25e-76	-	MELVLFDELTPQQQEAWLHDEALDMAHRWLRGRRQREMLAKMYHHERVYGPRGSRWGYSADPRRILIALLRRDLVIKCDSAVPPPRPGLQLWRLSDMGRRTAKIIVEEKL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Bxz1

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder