Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000882195.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Konstantine	NC_011292.1	YP_002242147.1	63527	63832	+	102	-3.5	5.0462	Acr	0.471990389	18	-2.9163785	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Konstantine_NC_011292-gi\|206600072\|ref\|YP_002242147.1\|\|1.30e-72	-	MGGPVSTFLYLQCDSHEPSIRSDGEVGQHLYDLSDVRRYIANRDLLAQIVDMDLGVNFDSHFANNAAYFLQKHRTCKISIQDEYGKQYDTIGDSHEPIGRQ	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Barnyardvirus; Mycobacterium virus Konstantine
Acr-Aca 1	Low Confidence	Mycobacterium phage Konstantine	NC_011292.1	YP_002242148.1	63829	64233	+	135	-24.5	3.8654	Acr	0.693033445	3	-1.1034652	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Damien_NC_024371-gi\|658311325\|ref\|YP_009044077.1\|\|5.19e-97	-	MKLEDTHGGYHGKSLQDKIRDDLDEAYKMHRNEEEAFGQDTERNDRFAEGIAHALGVLRGTDADVEWEAAQERYDNPVTPEPVADEPQVCCPDHNRPIINITNFTNVTNIVNSVDSDEEWDEFDDVEGDDDFED	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Barnyardvirus; Mycobacterium virus Konstantine
Acr-Aca 1	Low Confidence	Mycobacterium phage Konstantine	NC_011292.1	YP_002242149.1	64251	64598	+	116	-1	5.7519	WP_148195118.1\|HTH_31-1-AcrIIA7\|56.0\|0.0057	0.485082693	12	-2.202133	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Konstantine_NC_011292-gi\|206600074\|ref\|YP_002242149.1\|\|2.78e-83	-	MGIAMDEYEAREREMGENPCLTRAEIKPDRKVFVDENTTITVPKTVNGRINVMLSCRCGATVIVPLRSVEDRRDGNHLDFKVPDGWYADGGFPYARNPDEAYIVRCPQHRAALLG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Barnyardvirus; Mycobacterium virus Konstantine

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder