Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000883035.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Bacteroides phage B40-8	NC_011222.1	YP_002221565.1	29473	29832	+	120	1	7.9523	ERS698714\|NODE_351_length_1619_cov_3.395780_1\|HTH_XRE\|AcrIIA1\|44.0\|0.0034	0.787142915	2	-0.8538784	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_B40_8_NC_011222-gi\|200003983\|ref\|YP_002221565.1\|\|9.52e-83	-	MQEISKKLSEQSVEKVLDRPEYRKELSVYWEGLKKKREKVSFQILKNGGIPKRITIDRVDKMDIDQLVSEFKLILDRNSELPASLRYFISDVCGKVFISWFTKVIEDEAKENNDTREGN	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Bacteroides phage B40-8
Acr-Aca 1	Low Confidence	Bacteroides phage B40-8	NC_011222.1	YP_002221566.1	29792	30229	+	146	-4	4.7389	Acr	0.708014623	16	-2.5194237	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_B40_8_NC_011222-gi\|200003984\|ref\|YP_002221566.1\|\|1.45e-105	-	MKQKKITIPGKVTKDGKLSIYMGELNEFMKNNAGKNIIAEFTVLEPSDSSSLRGYYFKYVVPQFQKGMCENGYRWSEEQTESYMRSICPITMGEVVDVETGEYRKDSVKVTDLSNSEFIEYIDFLKQFAAEEFSIYIEEPNRFVR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Bacteroides phage B40-8
Acr-Aca 1	Low Confidence	Bacteroides phage B40-8	NC_011222.1	YP_002221567.1	30226	30540	+	105	0.5	6.7154	Acr	0.655445339	3	-0.9953526	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_B40_8_NC_011222-gi\|200003985\|ref\|YP_002221567.1\|\|2.38e-73	-	MKENEEMTLEEKFNLMCEALSISPKKIIDRDITRYVSLRRNCIIHQLYAYKNHGLPELIGRTKVLIMKAHERFQGELDVKDMTAVEFVRLIDERLQKYIDGKED	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Bacteroides phage B40-8

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder