Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000883935.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Vibrio phage VEJphi	NC_012757.1	YP_002925196.1	5403	5813	-	137	8.5	10.1881	Acr	0.391086491	8	-5.25119	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_VEJphi_NC_012757-gi\|238821381\|ref\|YP_002925196.1\|\|3.17e-99	-	MLIKLPILGVLSMNRSEMTKNFVFREFECGLSVEEAAKLCFKTVNEVKQWDAGEKIPPICKRLMRWHSRKELYYGDEWWGFRMEGGRLIFPTGDRVAPQQLLAAIAILQIQAPDDAMTRSKLLKYARAMARIKGIK	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Fibrovirus; Vibrio phage VEJphi
Acr-Aca 1	Low Confidence	Vibrio phage VEJphi	NC_012757.1	YP_002925197.1	5905	6201	-	99	2	8.4499	AcrIIA1-1-WP_029164156.1\|HTH_XRE\|32.7\|5.6e-05	0.170548136	4	-4.8161726	Not found in Prophage	Not found in Prophage	PHAGE_Vibrio_VEJphi_NC_012757-gi\|238821382\|ref\|YP_002925197.1\|\|6.78e-68	-	MYANELLNAYKKAKNYIQDKQIAHDLNLQPSMISKIRTGIRYVSDEEAIFLAESAGIEPEIALLGIHADRNENPRIKALWESIAKKQNGLGLRTISML	No	No	Viruses; Hofneiviricota; Faserviricetes; Tubulavirales; Inoviridae; Fibrovirus; Vibrio phage VEJphi

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder