Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000886135.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pseudomonas phage phi-2	NC_013638.1	YP_003345490.1	21538	21942	+	135	3	7.3495	Acr	0.498151608	9	-4.326913	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_phi_2_NC_013638-gi\|281306684\|ref\|YP_003345490.1\|\|3.18e-96	-	MVEWVIQDVLNTVPELCWGGREEAADRIVRATVEVDRYELCAFANGKPVGICVLVSEEDPHVGPCLGVMWHWVHPAHSGELGKLFLKRAIELAKENSLPCIAFSHRIKEGEYRIKYRRVHGQVSPSAAAGVVRR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Tunggulviirus; Pseudomonas virus f2
Acr-Aca 1	Low Confidence	Pseudomonas phage phi-2	NC_013638.1	YP_003345491.1	21896	22393	+	166	11.5	9.8658	3300005515_____Ga0077122_10000641_39\|HTH_38\|AcrIIA14\|36.4\|7.4e-07	0.079689142	6	-4.115861	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_phi_2_NC_013638-gi\|281306685\|ref\|YP_003345491.1\|\|5.21e-121	-	MGKLVQARLLELFVDNDGQLVRRVAKGKAPAGAVCEGRTNNGYYRVRVDGVYQLVHRVLWTMRHGDIPTELLVDHRDGNGYNNSIDNLRLATHGQNMQNAITHTGNTSGHRGVHWSVAAGKWQVQCNANGRNHYGGLFVDYSAACAAADTMRLTLHGKFAGGNYR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Tunggulviirus; Pseudomonas virus f2
Acr-Aca 1	Low Confidence	Pseudomonas phage phi-2	NC_013638.1	YP_003345492.1	22362	22745	+	128	3	10.0584	Acr	0.259676694	16	-4.6667957	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_phi_2_NC_013638-gi\|281306686\|ref\|YP_003345492.1\|\|2.36e-88	-	MGNSREVTIGKKVKKLVGKIKKFTEKWDPLGAGTLNQFVDPMADQWLGTDFTGMKALEAQNAADATARNEALLAQLGQQQAASNVDLGFENTPDTQVGGTANSLTTSSTTKKKKAPGGVASSLGINV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Tunggulviirus; Pseudomonas virus f2

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder