Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000894995.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Synechococcus phage S-CBS1	NC_016164.1	YP_004934613.1	11563	11886	+	108	-8	4.2354	WP_014245624.1\|HTH_3\|AcrIIA15\|34.9\|0.0016	0.208199791	22	-4.556885	Not found in Prophage	Not found in Prophage	PHAGE_Synech_S_CBS1_NC_016164-gi\|356870807\|ref\|YP_004934613.1\|\|2.38e-73	-	MPADGGKREKQSFEAEFKRLPQSRIAEIQAMAQKLVKAVEAGEQLEGISDVSVADEVLVGWSGILDEDGEEVPYSETNKAILLEVPLMAASLVQAYFASLTDEKRKN	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Synechococcus phage S-CBS1
Acr-Aca 1	Low Confidence	Synechococcus phage S-CBS1	NC_016164.1	YP_004934614.1	11952	12215	+	88	-12	3.7957	Acr	0.184013302	5	-3.1244318	Not found in Prophage	Not found in Prophage	PHAGE_Synech_S_CBS1_NC_016164-gi\|356870808\|ref\|YP_004934614.1\|\|3.67e-58	-	MGIELPDDLVPDGRDDYEVTPDAWPAVSMFLKVQTQWRVGMGAVIGLDYGALRWCFELEEVDNPRELLEDLQVIEGRVVEILSQRDG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Synechococcus phage S-CBS1

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder