Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000895275.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Salmonella phage SPN1S	NC_016761.1	YP_005098019.1	34517	34750	+	78	6.5	10.2142	AcrIIA7-0-3300009082_____Ga0105099_10002817_4\|HTH_19\|40.5\|0.0038	0.476398199	23	-4.3016477	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_SPN1S_NC_016761-gi\|374531235\|ref\|YP_005098019.1\|\|2.87e-53	-	MSDEKKFDFKKHWLGLSPDEREAFAVEAGTTSHYIQTHLTGRRKMPGKRLMEGLFKACRSREWTKSKPELVLFFYDR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Uetakevirus; Salmonella virus SPN1S
Acr-Aca 1	Low Confidence	Salmonella phage SPN1S	NC_016761.1	YP_005098020.1	34894	35097	+	68	9	10.3229	Acr	0.17306978	13	-3.4076424	Not found in Prophage	Not found in Prophage	PHAGE_Salmon_SPN1S_NC_016761-gi\|374531236\|ref\|YP_005098020.1\|\|3.13e-44	-	MKRITQREALDLGLTRFYTGKQCIHGHDCERYTLSGECVKCNNERARRQAKLRSEKMKAAKTAREAA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Uetakevirus; Salmonella virus SPN1S

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder