Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000896255.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Staphylococcus phage TEM123	NC_017968.1	YP_006382296.1	40980	41348	-	123	15	10.7427	AcrIIA3-1-3300010369_____Ga0136643_10000412_64\|HTH_DeoR\|36.4\|0.0026	0.250327218	26	-3.2991538	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_phiBU01_NC_026016-gi\|744692816\|ref\|YP_009113130.1\|\|7.60e-87	-	MARKARIVTINDKPYRFSKFEMELIESHGITAGMVSKRVKDGWELHEAMDAPEGTRLSEYREKKTIERLEQARLERKLERKRKREAELRRKKPHLFNVPQKHPRGRYACYLMENDIFVKVKK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage TEM123
Acr-Aca 1	Low Confidence	Staphylococcus phage TEM123	NC_017968.1	YP_006382297.1	41361	41777	-	139	8.5	9.8904	Acr	0.073603607	13	-2.1738055	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_TEM123_NC_017968-gi\|388570357\|ref\|YP_006382297.1\|\|2.34e-101	-	MRDYMEIEIKFNEVFNAPMGSPRPRFRKTGRYAHTYMPTKYTEHKKYLQNQMPKLNLENALKIELEFYFPLLKSWSKKKKSEMVGQYKVTKPDIDNLIKTVLDACNGHVWKDDNQITEITSSKRYGIEPKIIIRIEEI	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage TEM123

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder