Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000900335.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Pseudomonas phage UFV-P2	NC_018850.2	YP_006907044.2	43945	44451	-	169	3.5	8.8257	Acr	0.109310908	56	-4.990684	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_UFV_P2_NC_018850-gi\|496838654\|ref\|YP_006907044.2\|\|8.32e-122	-	MSLQSCLTMSPDWLRSSISRSLTPSHDLVKRREGLVLKWYKDSLGKLTAGYGHLQKPGEASLVVTKALADAWFEGDIGWAEDAALRQSLQLPFVTQDLLDKLVSVNFQLGAGWTGTFKKTWALLLAGKYAEAAREAEDSNWHKQTPVRVRDFQEALWRTQTLYDLYKG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Vicosavirus; Pseudomonas virus UFVP2
Acr-Aca 1	Low Confidence	Pseudomonas phage UFV-P2	NC_018850.2	YP_006907043.1	44372	44845	-	158	-0.5	6.2403	AcrIIA7-1-7000000006_____C1540887_6\|HTH_38\|35.1\|0.00022	0.256182452	33	-4.2176156	Not found in Prophage	Not found in Prophage	PHAGE_Pseudo_UFV_P2_NC_018850-gi\|410491821\|ref\|YP_006907043.1\|\|4.50e-116	-	MTDQTKVVDITSAPLTPKEKLDLYCEALCDGYNKTQAYIKAGFSAAHAQRNVAPYHRKNADYIKAYLSEQFGSDAPMARNVIRAIMNDETEKGGIRLKAAQDILDRAGFGAKQQIEVTTKDVTELSTEDITNELAKLFNDEPGLAKVIHLPIANSKS	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Vicosavirus; Pseudomonas virus UFVP2

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder