Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000905995.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Sulfitobacter phage phiCB2047-B	NC_020862.2	YP_007675796.1	4566	4889	+	108	3	9.8232	Acr	0.392099213	69	-5.1619864	Not found in Prophage	Not found in Prophage	PHAGE_Sulfit_phiCB2047_B_NC_020862-gi\|472342287\|ref\|YP_007675796.1\|\|1.07e-74	-	MLAKFQSYILIGLLAFSVVAGGATFYLWNKNSDLRQELSKVEAALEKSKTNLALVSIQLMKERETRAVAERALSKLKDVPDVDYKTPLPKSIGNILNDFSDRMRGQD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Baltimorevirus; Sulfitobacter phage phiCB2047-B
Acr-Aca 1	Low Confidence	Sulfitobacter phage phiCB2047-B	NC_020862.2	YP_007675797.1	4855	5076	+	74	-5	4.1435	WP_057561667.1\|HTH_CodY-0-AcrIIA8\|64.0\|1.1e-05	0.452851577	7	-1.9620118	Not found in Prophage	Not found in Prophage	PHAGE_Sulfit_phiCB2047_B_NC_020862-gi\|472342288\|ref\|YP_007675797.1\|\|2.26e-47	-	MTSVTGCGDKINLLGSEGIPDESFKGIKPVYADGSNVGNLTEAYLKNTESLVVVNGRIGVLCEANEIEDCGNK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Baltimorevirus; Sulfitobacter phage phiCB2047-B

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder