Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000910475.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Cellulophaga phage phi4:1	NC_021788.1	YP_008240705.1	107974	108240	+	89	-0.5	5.8448	AcrIIA7-0-3300012983_____Ga0123349_10006117_9\|HTH_26\|46.2\|2.7e-18	0.150224202	98	-3.099293	Not found in Prophage	Not found in Prophage	PHAGE_Cellul_phi4:1_NC_021788-gi\|526176843\|ref\|YP_008240705.1\|\|1.36e-61	-	MTKFRKKPVVIDAIKFTRNTFDEVKAFTEGQAHTLSIERSINGKCTCVIPTLEGPMTASENDWIIKGVSGEFYPCKPDIFEKTYEEVG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Lightbulbvirus; Cellulophaga virus Cba41
Acr-Aca 1	Low Confidence	Cellulophaga phage phi4:1	NC_021788.1	YP_008240706.1	108262	108414	+	51	3.5	9.7703	Acr	0.206806303	197	-5.6443233	Not found in Prophage	Not found in Prophage	PHAGE_Cellul_phi4:1_NC_021788-gi\|526176844\|ref\|YP_008240706.1\|\|1.82e-29	-	MYALQTRYPSRRPPPVLRLFGYPLGSGPIDFFHALDLFKMSLGLFYFYYL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Podoviridae; Lightbulbvirus; Cellulophaga virus Cba41

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder