Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000916495.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Acinetobacter phage Petty	NC_023570.1	YP_009006537.1	36781	37134	+	118	-4.5	4.3707	AcrVA5-1-WP_028623608.1\|HTH_3\|46.2\|0.0043	0.276235226	39	-5.3780007	Not found in Prophage	Not found in Prophage	PHAGE_Acinet_Petty_NC_023570-gi\|589890682\|ref\|YP_009006537.1\|\|3.33e-80	-	MNIVDWFYAVLIYVWSELDKVALSASTSAIVVAVLRMRKHGKILWSEALLCGVFATIAIVGLQFILAVLGLPSDGWVNAVVDGGSTVIGAGIGWYGTDRTVEFLENKVGGRDEQDTE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Pettyvirus; Acinetobacter virus Petty
Acr-Aca 1	Low Confidence	Acinetobacter phage Petty	NC_023570.1	YP_009006538.1	37115	37702	+	196	9.5	9.1676	Acr	0.14145874	16	-4.103596	Not found in Prophage	Not found in Prophage	PHAGE_Acinet_Petty_NC_023570-gi\|589890683\|ref\|YP_009006538.1\|\|3.84e-147	-	MSKTLSEYGQRELADLYGIPLAAMKAIVEVECKGSGFNSDGTPVILYERHKFYEGLRAINWITKAREWSQKYPDLCNPYAGGYGKYSEQHKKLDRAAELNRTVALESCSWGLGQVMGYHWKSLGYTNLQEFINCMYKSEYCQLDAMCRFIEVNKLLPFIRKKDWAGFAMRYNGGGYRKNQYDTKLSAAYKKFGGV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Pettyvirus; Acinetobacter virus Petty
Acr-Aca 1	Low Confidence	Acinetobacter phage Petty	NC_023570.1	YP_009006539.1	37702	38025	+	108	-8	4.3741	Acr	0.519686156	2	-2.0314333	Not found in Prophage	Not found in Prophage	PHAGE_Acinet_Petty_NC_023570-gi\|589890684\|ref\|YP_009006539.1\|\|3.11e-72	-	MSRKKSASVAELEALHAATARYLKGRLEDSTRQSEDEDDFVLPLATGEVANIIAFLKHNNISAAPDAEEVSELKQEFANDLEAQRIAKAEGLLRASDEDLERAAWLS	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Autographiviridae; Pettyvirus; Acinetobacter virus Petty

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder