Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000916615.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Psychrobacter phage Psymv2	NC_023734.1	YP_009017575.1	5509	5733	+	75	2	7.8629	AcrIIA7-2-WP_068305859.1\|HTH_3\|40.4\|2.7e-06	0.150779081	40	-5.0036483	Not found in Prophage	Not found in Prophage	PHAGE_Psychr_Psymv2_NC_023734-gi\|593779747\|ref\|YP_009017575.1\|\|3.69e-49	-	MTPSQKSYKRLVAHFGGQQKTAAALGCTQPSVWAWLQGNAHMSAVLALKAEKLTNGEISSSELCPALASLEAVE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Psychrobacter phage Psymv2
Acr-Aca 1	Low Confidence	Psychrobacter phage Psymv2	NC_023734.1	YP_009017576.1	5788	6231	+	148	-2.5	5.8264	Acr	0.097305639	34	-4.6054587	Not found in Prophage	Not found in Prophage	PHAGE_Psychr_Psymv2_NC_023734-gi\|593779748\|ref\|YP_009017576.1\|\|1.77e-107	-	MDVIDAAHKTVHNPNHGGSTAIAARMGMSSTVLNNKVNPATNSHHLRLDEALTIMEYTNDTSIIQAMAQRLGGVFTLVESDTTQASIIMTALSTSACQGDVMSEMHKALEDGRIDCSEHDALQTKIQDTMKMLRTLAIQITQYCEGR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Psychrobacter phage Psymv2
Acr-Aca 1	Low Confidence	Psychrobacter phage Psymv2	NC_023734.1	YP_009017577.1	6234	6440	+	69	1	7.1059	Acr	0.648783505	2	-1.4451144	Not found in Prophage	Not found in Prophage	PHAGE_Psychr_Psymv2_NC_023734-gi\|593779749\|ref\|YP_009017577.1\|\|2.38e-45	-	MSAKNCNNCSYCKSIAAVEVTGDEHAIKREFERIERNQKIIDLGDKLEAIDHLKAKQAKSPSAVTDGL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Psychrobacter phage Psymv2

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder