Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000917195.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Donovan	NC_023552.1	YP_009004403.1	27486	27731	+	82	5.5	11.0845	WP_098361218.1\|HTH_17-0-AcrIF10\|34.5\|0.0005	0.252015775	20	-4.050897	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Fishburne_NC_021302-gi\|508178461\|ref\|YP_008051257.1\|\|7.21e-53	-	MVRHMPTTTTRAGAATEIVASEACRILNVDRSTLLRWVAAEKVTPTRKLPGSTGAFLFDRDAIEELAAARKTARESRKASA	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fishburnevirus; Mycobacterium virus Donovan
Acr-Aca 1	Low Confidence	Mycobacterium phage Donovan	NC_023552.1	YP_009004404.1	27728	27964	+	79	11	12.2153	Acr	0.233629897	47	-5.0238237	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Donovan_NC_023552-gi\|589893078\|ref\|YP_009004404.1\|\|2.83e-49	-	MSRTVDELVASIAAQVRELVGNRTERGETTLYSLAILKGLQDKPTYAGTVPAAVVAERRRRNKVARRSRRINRQAARR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Fishburnevirus; Mycobacterium virus Donovan

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder