Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000917595.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Dandelion	NC_023696.1	YP_009012846.1	21995	22306	+	104	-5.5	4.6229	Acr	0.594465395	158	-4.9781837	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Dandelion_NC_023696-gi\|593774979\|ref\|YP_009012846.1\|\|1.63e-72	-	MGAQLTPDELAGAAMRPRYQQLTPVIDYEAALRRFLAEELPPDTIFDAEHLNLGLQLVIEFNRDIWQHRVPSTWEMVLADRAGRLEEHIAEIESEYQRSKEKK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Dandelion
Acr-Aca 1	Low Confidence	Mycobacterium phage Dandelion	NC_023696.1	YP_009012847.1	22303	22509	+	69	1.5	7.3193	Rampelli_10023_NODE_1391_length_7026_cov_4.689715_4\|HTH_XRE-1-AcrIIA15\|39.6\|8.4e-06	0.528509491	64	-3.6784687	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Sebata_NC_041993-gi\|100065\|ref\|YP_009608750.1\|\|1.22e-44	-	MTTSVVHNQLQVELIHKVTEGMEANGWSQGDLERHSGVAQPNISNLLSGKRLGTLSTWNKLLRAVEAP	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Dandelion
Acr-Aca 1	Low Confidence	Mycobacterium phage Dandelion	NC_023696.1	YP_009012848.1	22506	22814	+	103	1	7.1363	Acr	0.30590411	173	-5.118934	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Dandelion_NC_023696-gi\|593774981\|ref\|YP_009012848.1\|\|2.08e-72	-	MSGLTPTQELVLEVLAARHRLGEQFWTFPNRRAIRKASRELAEAGLVWCDTAPTPGSFRVGLTEQGKLACIDPGYVPPVERTDREAIRKRMHEMIDNVLDGV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Dandelion
Acr-Aca 1	Low Confidence	Mycobacterium phage Dandelion	NC_023696.1	YP_009012849.1	22814	23149	+	112	7	10.3323	Acr	0.464739937	150	-4.906878	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Lukilu_NC_041901-gi\|100058\|ref\|YP_009597661.1\|\|2.43e-77	-	MVELVLFDELTPQQQEAWLHDEALDMAHRWLRGRRQREMLAKMYHHERVYGPRGSRWGYSADPRRILIALLRRDLVIKCDSAVPPPRPGLQLWRLSDMGRRTAKIIVEEKL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Myoviridae; Bixzunavirus; Mycobacterium virus Dandelion

Showing 1 to 4 of 4 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder