Results - Acr-Aca DB

Anti-CRISPR Results - GCF_000920955.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Lactococcus phage P078	NC_024215.1	YP_009036880.1	38972	39205	+	78	1.5	7.3169	3300009687_____Ga0116144_10002625_16\|HTH_AsnC-type-3-AcrIIA7\|50.0\|0.0015	0.438782645	23	-2.4855597	Not found in Prophage	Not found in Prophage	PHAGE_Lactoc_P118_NC_024208-gi\|643654647\|ref\|YP_009035872.1\|\|7.21e-52	-	MGESEEEMMEWLREIDRYYGFGHFQSHIGPPYKKINEDLIIYLHNEGWSNRAISREIGVARRTIDRRIIKLKSEGRL	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Lactococcus phage P078
Acr-Aca 1	Low Confidence	Lactococcus phage P078	NC_024215.1	YP_009036881.1	39205	39384	+	60	1.5	8.4945	Acr	0.17194244	74	-5.1980968	Not found in Prophage	Not found in Prophage	PHAGE_Lactoc_P078_NC_024215-gi\|643655034\|ref\|YP_009036881.1\|\|7.44e-36	-	MKSWYKLVAVILIIIAVIYMGSNLATQGSVHGVVVDKAVKVESTGKTTDSKYLVFVETD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; UNKNOWN_genus; Lactococcus phage P078

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder