Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001041295.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Propionibacterium phage PHL055N00	NC_027400.1	YP_009153248.1	28714	28863	+	50	3.5	9.8588	Acr	0.160507617	25	-4.34616	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PHL194M00_NC_027392-gi\|100044\|ref\|YP_009152750.1\|\|3.60e-31	-	MIFFTPMGVVEKTNTPAQTEHPLKRTKQPPESIGRARVEYSYPQRFPGC	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium phage PHL055N00
Acr-Aca 1	Low Confidence	Propionibacterium phage PHL055N00	NC_027400.1	YP_009153249.1	28911	29213	+	101	8.5	10.9317	3300017963_____Ga0180437_10001802_15\|HTH_24\|AcrVA3\|37.0\|1.5e-06	0.144598819	19	-4.1071544	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PHL194M00_NC_027392-gi\|100045\|ref\|YP_009152751.1\|\|4.03e-70	-	MARTNRTASSAHRRWRQRLITQARQQGQTECPLCGTTITWDTHDLPTSPEADHITPVSRGGLNTLDNGQIICRTCNRSKGNRSEPNIKFQQQTTKTLIPW	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium phage PHL055N00

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder