Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001470955.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Propionibacterium phage PA1-14	NC_028694.1	YP_009191389.1	28864	28995	+	44	5	10.3184	Acr	0.182734935	15	-3.8381314	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PA1_14_NC_028694-gi\|966201312\|ref\|YP_009191389.1\|\|2.18e-25	-	MGVVEKTTTPPHTEHPLKRTKQTPESICRARARYSYPQQLPSP	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium phage PA1-14
Acr-Aca 1	Low Confidence	Propionibacterium phage PA1-14	NC_028694.1	YP_009191390.1	29043	29345	+	101	8	10.4726	3300017963_____Ga0180437_10001802_15\|HTH_24\|AcrVA3\|37.0\|1.5e-06	0.144281861	23	-4.287185	Not found in Prophage	Not found in Prophage	PHAGE_Propio_PA1_14_NC_028694-gi\|966201313\|ref\|YP_009191390.1\|\|1.59e-70	-	MAHTNRTASAAHRRWRQRLITQAQQQGQTECPLCGATITWNTHDLPTSPEADHITPVSRGGLNTLDNGQIICRTCNRSKGNRSEPNIKFQQQTTKTLIPW	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Pahexavirus; Propionibacterium phage PA1-14

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder