Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001504615.1 (Total 3 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209137.1	7043	7204	+	54	-1	4.4787	Acr	0.304153507	65	-5.4550147	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755300\|ref\|YP_009209137.1\|\|7.02e-32	-	MSNIYKSYLVAVLCFIVLAICLMPLLYFTTAWSIAGFASIATFIFYKEYFYEE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 1	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209138.1	7261	7557	+	99	-4.5	4.721	Acr	0.68669729	4	-0.25643432	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755301\|ref\|YP_009209138.1\|\|1.06e-67	-	MFNIKRKTEEVKVYYEIGDIIRKNIHVNGFDFKLFILKGHMGISIQVKDMNNVPIKHAYVVDENDLEMASELFNQAIDEWIEENTDEQDRLINLVMRW	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 1	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209139.1	7567	7788	+	74	-2.5	5.0747	Acr	0.484313472	6	-0.3819489	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_phiETA_NC_003288-gi\|17426244\|ref\|NP_510910.1\|\|8.28e-49	-	MNQTVTYIIRHRDMPIYITNKPTDNNSDVSYSTNRNRAREFNGMEEASINMDYHKAIKKTVTETIEYEEVEHD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 1	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209136.1	6829	7050	+	74	1.5	8.516	AcrIIA15-0-3300000114_____IMNBL3_c10000736_39\|HTH_17\|47.8\|6.6e-09	0.225892911	29	-2.8160422	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755299\|ref\|YP_009209136.1\|\|4.77e-47	-	MIKNSLQAKEVAVILSVSKSKAGQIIRELNKELEDEGYIAIRGRIPVQLARKKFPYHDLSDERIMEELKKENE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209156.1	14768	15328	+	187	-7	4.8945	3300011228_____Ga0122781_100084_48\|HTH_3\|AcrIIA1\|31.6\|0.00012	0.231993989	35	-3.097412	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755319\|ref\|YP_009209156.1\|\|4.87e-138	-	MTNTLTIDQLQELLQIQKEFDDRIETKNPKDTHKAYVEEFFEWYNTIEPFKNWKKIKGKPIEEQLDELSDMLAFALSYVLMTESYEESETYFCKMPELANQYSFLAKLHKVISVTEYHKLNKRHERTGDLEINHILDLLIDVELVLPFQIAVEYYSIDQLIDAYKKKMKRNHERQDGTADAGKGYV	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209162.1	16504	16905	+	134	6	9.5728	WP_141904623.1\|HTH_28-1-AcrIIA7\|31.0\|0.00027	0.387475591	54	-4.325787	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755325\|ref\|YP_009209162.1\|\|1.38e-96	-	MYSKESIVNMIGTHKMKCNVLADVIPEYDSNSIAQYGIQATLPKPQGENSSKVEDVVVRLERANKRYAQMLKEVEFINQSQQKLGHVDFCFLELLKKGYNRDAIIKKMPNSKLNRNNFLARRDELAEKIYLLQ	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209161.1	16327	16503	+	59	-5	4.0463	Acr	0.420171023	19	-2.0103345	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755324\|ref\|YP_009209161.1\|\|5.74e-37	-	MMIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDFAKLSDQCDLMRAEVSE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209160.1	16101	16337	+	79	-2.5	4.895	Acr	0.494613764	7	-0.8412231	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755323\|ref\|YP_009209160.1\|\|7.89e-51	-	MINIPKMKFPKKYTEIIKKYKNKTPEEKAKIEDDFIKEINDKDSEFYSPMMANMNEHELRTMLRMMPSLIDTGDENDD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209159.1	15818	16108	+	97	-3.5	4.9535	Acr	0.607301167	30	-2.847511	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755322\|ref\|YP_009209159.1\|\|3.54e-67	-	MTTQYLVTTFKDSTGRKHTHITRAKSNQRFTVVEAESKEEAKEKYEARNKPVDGATSLNDIKSNIGIFHVEKVEPNEGMVDINIETMKPFEEADDD	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236
Acr-Aca 2	Low Confidence	Staphylococcus phage B236	NC_028915.1	YP_009209158.1	15555	15821	+	89	-6	4.303	AcrIIA7-0-3300012983_____Ga0123349_10006117_9\|HTH_26\|36.2\|1.1e-15	0.154188198	43	-3.6045756	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_B236_NC_028915-gi\|971755321\|ref\|YP_009209158.1\|\|2.40e-59	-	MIRKARKKPVEIEFVKYTGDNQREIYEWTNGRAYNVPDYDDDDITYFGVATLEGFLIAEVGSYIVKGVEGEFYPVEPNIFKKTYEVID	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Phietavirus; Staphylococcus phage B236

Showing 1 to 10 of 29 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder