Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001504675.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Staphylococcus phage phiIPLA-RODI	NC_028765.1	YP_009195887.1	25038	25268	-	77	2	8.4666	AcrIIA1-0-WP_081533608.1\|HTH_XRE\|35.7\|2.2e-07	0.143106157	96	-2.3413005	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_phiIPLA_RODI_NC_028765-gi\|971741327\|ref\|YP_009195887.1\|\|2.34e-50	-	MDEKKESKPLNLQKIRVEKGHTLRSLASEIGVHYSLISYWEYGKKKPRSANLMRLEKALNTPGKELFKELEEDDGE	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Kayvirus; Staphylococcus virus Rodi
Acr-Aca 1	Low Confidence	Staphylococcus phage phiIPLA-RODI	NC_028765.1	YP_009195888.1	25271	25498	-	76	10	10.4377	Acr	0.586177937	34	-0.7581252	Not found in Prophage	Not found in Prophage	PHAGE_Staphy_phiIPLA_RODI_NC_028765-gi\|971741328\|ref\|YP_009195888.1\|\|2.35e-48	-	MNKFKRWFRINVLKKETLLFKVYWRYESPSLKKPHVFYIELYAKSKAEARDKSHEYILKNAKASEDFKFLKVEEK	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Herelleviridae; Kayvirus; Staphylococcus virus Rodi

Showing 1 to 2 of 2 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder