Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001505055.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Mycobacterium phage Kratio	NC_028947.1	YP_009212787.1	34179	34565	+	129	9	11.3222	SRS2159246\|NODE_6248_length_459_cov_1.084158_1\|HTH_3\|AcrIIA1\|47.8\|0.0018	0.217386665	60	-4.860042	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Kratio_NC_028947-gi\|971759469\|ref\|YP_009212787.1\|\|3.83e-92	-	MSAFPFIWCTVLHVTATNTLTTPSSDTRNTTYVVPVFELKWNADAVADLCFRNGIRSRNQLAQRINVPRSTVYETFSKDWEGTATVQVLAQMAGVFGVPLGILVREPGRGRRAAATPRVNRHVTKRAG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Kratio
Acr-Aca 1	Low Confidence	Mycobacterium phage Kratio	NC_028947.1	YP_009212788.1	34572	34862	+	97	-4	4.9978	Acr	0.3666027	2	-1.0916752	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Kratio_NC_028947-gi\|971759470\|ref\|YP_009212788.1\|\|2.05e-63	-	MIHKRRSEADYSRVVAERDAGRRIIAEQSDQLRELTDRFQTAVAGIAAGHAAHLDVTNELERVTRERDEAVLRVEQLLEARRLDDLHEEPDMDRCG	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Kratio
Acr-Aca 1	Low Confidence	Mycobacterium phage Kratio	NC_028947.1	YP_009212789.1	34940	35092	+	51	-2.5	3.8748	Acr	0.149983864	74	-5.2461042	Not found in Prophage	Not found in Prophage	PHAGE_Mycoba_Kratio_NC_028947-gi\|971759471\|ref\|YP_009212789.1\|\|8.48e-29	-	MSPDSLTHNPPAEPPNTDPMSVGSFIGWTILLASTLISAILLGALSVGML	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Timquatrovirus; Mycobacterium phage Kratio

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder