Results - Acr-Aca DB

Anti-CRISPR Results - GCF_001551725.1 (Total 1 loci with Aca homologs)

1. Guilt-by-Association

1.1 Guilt-by-Association (Tabular View)

Show entries

Search:

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)

Loci ID	Classification	Organism	Refseq ID	Protein ID	Start	End	Strand	aa Length	Charge	Isoelectric Point	Acr/Aca	PaCRISPR_score	AcRanker Rank	AcRanker Score	AcRanker Rank Prophage	AcRanker Score Prophage	MGE/Propahge Metadata	Acr_Hit	sequence	Self Target w/in 5000 BP	Self Target Outside 5000 BP	lineage(Kingdom;Phylum;Class;Order;Family;Genus;Species;SubSpecies)
Acr-Aca 1	Low Confidence	Paenibacillus phage Rani	NC_029084.1	YP_009224901.1	23280	23498	+	73	-1	5.6567	Acr	0.5423454	52	-4.7603803	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_Rani_NC_029084-gi\|985759367\|ref\|YP_009224901.1\|\|3.04e-48	-	MHRETIKKVNETITSLCDYIQDLIERNPADAIGALPSLVEALAKITEVEVLDQALGKQLELFSATGGTHKRR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Sitaravirus; Paenibacillus virus Rani
Acr-Aca 1	Low Confidence	Paenibacillus phage Rani	NC_029084.1	YP_009224902.1	23543	23770	+	76	1	8.4209	Acr	0.563612172	3	-0.92481375	Not found in Prophage	Not found in Prophage	PHAGE_Bacter_Rani_NC_029084-gi\|985759368\|ref\|YP_009224902.1\|\|5.80e-50	-	MNKEMAILKNPREPRIPARNEEDKKARENMFEAAGYTYDQAYLTLEAINDSLLFSSRFVSVRNRPEELKDAKYTR	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Sitaravirus; Paenibacillus virus Rani
Acr-Aca 1	Low Confidence	Paenibacillus phage Rani	NC_029084.1	YP_009224903.1	23776	24039	+	88	-1	5.1726	WP_044261583.1\|HTH_24\|AcrIIA1\|57.9\|0.00064	0.631422868	20	-2.7550712	Not found in Prophage	Not found in Prophage	PHAGE_Paenib_Xenia_NC_028837-gi\|971748196\|ref\|YP_009201960.1\|\|4.96e-58	-	MNQKQQQGIAAQEWTVVIVDGYNIQQSIVDEKDRDSKKSQLQLELTFYSNDLSAVKFEDFLQDLQEFIKERNRRYKELARKRSEINQ	No	No	Viruses; Uroviricota; Caudoviricetes; Caudovirales; Siphoviridae; Sitaravirus; Paenibacillus virus Rani

Showing 1 to 3 of 3 entries

1.2 Guilt-by-Association (Graphic View)

Download SVG PNG

1.3 Guilt-by-Association (Jbrowse View)

2. Homology Based

No result on Homology Based method

3. CRISPRCasFinder Summary

No result on CrisprCasFinder